BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0208.Seq (726 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 28 0.26 AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding prot... 27 0.59 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 26 1.4 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 25 3.2 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 4.2 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 24 4.2 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 24 5.5 AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CY... 24 5.5 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 24 5.5 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 23 9.6 AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. 23 9.6 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 9.6 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 9.6 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 28.3 bits (60), Expect = 0.26 Identities = 17/61 (27%), Positives = 27/61 (44%), Gaps = 1/61 (1%) Frame = +2 Query: 44 TAPTQEMEQPEGQKVQDGAPVQ-MSLPWGLTPADLHAIHRSAQHAIDQSRREQQMDNDMQ 220 TA Q+ P+G+ A Q + LP + +HRS Q Q +++QQ Q Sbjct: 1259 TAQHQDPRGPQGRSTDYHATQQPLPLPGLASEMQPQQLHRSQQQQQQQQQQQQQQQQQQQ 1318 Query: 221 E 223 + Sbjct: 1319 Q 1319 >AY578802-1|AAT07307.1| 108|Anopheles gambiae FK506-binding protein protein. Length = 108 Score = 27.1 bits (57), Expect = 0.59 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +2 Query: 407 IRCWRAGNA*SAVLANVPRVCSRLYNIGSRSHSGL 511 IR W G A +V VCS Y GSR H G+ Sbjct: 57 IRGWDEGVAQMSVGQRAKLVCSPDYAYGSRGHPGV 91 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 25.8 bits (54), Expect = 1.4 Identities = 17/75 (22%), Positives = 30/75 (40%), Gaps = 1/75 (1%) Frame = +2 Query: 2 QNEQQTIVHQFVP-QTAPTQEMEQPEGQKVQDGAPVQMSLPWGLTPADLHAIHRSAQHAI 178 Q +QQ ++VP Q ++ +Q Q+ Q Q P L + QH Sbjct: 254 QQQQQQQGERYVPPQLRQQRQQQQRPRQQQQQQQQQQQQQGERYVPPQLRQQRQQQQHQQ 313 Query: 179 DQSRREQQMDNDMQE 223 Q +++QQ ++ Sbjct: 314 QQQQQQQQRQQQQRQ 328 Score = 23.4 bits (48), Expect = 7.3 Identities = 12/40 (30%), Positives = 16/40 (40%), Gaps = 2/40 (5%) Frame = -1 Query: 201 CCSRRDWSIAC*A--ERCIACRSAGVKPHGRLICTGAPSC 88 C W+ C + +R C GV H +CT P C Sbjct: 665 CLELGHWAHDCRSPDDRQNMCIRCGVVGHMAKVCTSQPKC 704 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 24.6 bits (51), Expect = 3.2 Identities = 12/44 (27%), Positives = 19/44 (43%) Frame = -3 Query: 475 SRADSRHICKHSASRVSRPPASNRRCELSEAAYNVASRQCRVVP 344 + A R C+ + RP A C +Y+VA R++P Sbjct: 799 AEATDRQWCQRMLASFQRPLAQRVVCGFRSISYSVAVLMPRLIP 842 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 24.2 bits (50), Expect = 4.2 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 188 VTGRLHAERSGVSHAGRPGSSPTGDSSAPGHRP 90 V GRL A+ S ++ P +P + + PG P Sbjct: 360 VIGRLPADNSSALNSPNPARAPPRNFTMPGPGP 392 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.2 bits (50), Expect = 4.2 Identities = 12/31 (38%), Positives = 13/31 (41%), Gaps = 1/31 (3%) Frame = -2 Query: 164 RSGVSHAGRPGSS-PTGDSSAPGHRPAPSGP 75 R H G G+S P G APG P P Sbjct: 56 RGLTGHRGEKGNSGPVGPPGAPGRDGMPGAP 86 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 575 FILKSICIECCYKCLRL*LGDGARCAIASR 486 F+L I + CY C+ + L D AR S+ Sbjct: 277 FVLPFIIMAFCYICVSIRLNDRARTKPGSK 306 >AY193730-1|AAO62003.1| 441|Anopheles gambiae cytochrome P450 CYPm3r10 protein. Length = 441 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = +2 Query: 143 LHAIHRSAQHAIDQSRREQQMDNDMQEVK 229 +HAIHR +H D R + QE K Sbjct: 340 VHAIHRDPEHFPDPERFDPDRFTAEQEAK 368 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 23.8 bits (49), Expect = 5.5 Identities = 11/34 (32%), Positives = 12/34 (35%) Frame = -1 Query: 171 C*AERCIACRSAGVKPHGRLICTGAPSCTFWPSG 70 C +R C G K H C P C P G Sbjct: 445 CGPDRRDCCLRGGEKGHFAATCRLPPRCVLCPDG 478 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 156 CIACRSAGVKPHGRLICTGAPSCTFWPSGC 67 C+ C++ G K H C P T P C Sbjct: 191 CMRCKATGTKAHTAKYCPLKPVIT--PEDC 218 >AY583530-1|AAS93544.1| 260|Anopheles gambiae NOS protein protein. Length = 260 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = -1 Query: 156 CIACRSAGVKPHGRLICTGAPSCTFWPSGC 67 C+ C++ G K H C P T P C Sbjct: 192 CMRCKATGTKAHTAKYCPLKPVIT--PEDC 219 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 9.6 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +2 Query: 2 QNEQQTIVHQFVPQTAPTQEMEQPEGQKVQ 91 Q QT+ HQ+ Q Q+ +Q + Q+ Q Sbjct: 1294 QQPLQTLQHQYQQQLQQQQQQQQQQQQQHQ 1323 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.0 bits (47), Expect = 9.6 Identities = 14/49 (28%), Positives = 23/49 (46%) Frame = +2 Query: 62 MEQPEGQKVQDGAPVQMSLPWGLTPADLHAIHRSAQHAIDQSRREQQMD 208 +E P G ++ A + L G TPA + A A+D+ RE ++ Sbjct: 661 VELPPGAELIGYADDLVLLAPGTTPAAAAVVAEEAVSAVDRWLREHHLE 709 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 714,301 Number of Sequences: 2352 Number of extensions: 15412 Number of successful extensions: 55 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 49 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74012934 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -