BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0202.Seq (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 23 3.7 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 23 3.7 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 23 3.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.9 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 22 6.5 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 8.6 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 8.6 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 8.6 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 8.6 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 8.6 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 8.6 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +1 Query: 127 VAIRMPPVIPINH-----YLGVLKTN 189 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +1 Query: 127 VAIRMPPVIPINH-----YLGVLKTN 189 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 22.6 bits (46), Expect = 3.7 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 5/26 (19%) Frame = +1 Query: 127 VAIRMPPVIPINH-----YLGVLKTN 189 +A+ PPV+P NH YL V++ N Sbjct: 353 LAVPAPPVLPENHLKNAKYLDVIERN 378 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 660 SKEGSRRANYPLPARGGSDEK*RYG 586 +K S+ AN P PA GG + + G Sbjct: 1014 AKPQSQEANKPKPATGGKGTRPKRG 1038 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 21.8 bits (44), Expect = 6.5 Identities = 11/38 (28%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = -3 Query: 126 VRGEILGSSQ-DEHQRKHRQRCFHQSRTKVRGSKAIRY 16 V GEI + E K+R++C +++T + +A Y Sbjct: 22 VYGEISDIDEFREMTSKYRKKCIGETKTTIEDVEATEY 59 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +1 Query: 145 PVIPINHYLGVLKTNKIEPRSYSIIPCTKYSSSIFSPFEHS 267 P +N KT I R++ ++ YS+S F+P +S Sbjct: 287 PFFCVNIVTSYCKTC-ISGRAFQVLTWLGYSNSAFNPIIYS 326 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.6 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +2 Query: 422 SAAHKCNYELFNRNNFSIRYWSWNY 496 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,769 Number of Sequences: 438 Number of extensions: 4614 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -