BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0201.Seq (668 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g57380.1 68418.m07169 fibronectin type III domain-containing ... 31 0.69 At4g33630.2 68417.m04778 expressed protein 28 6.5 At4g33630.1 68417.m04777 expressed protein 28 6.5 At1g64960.1 68414.m07363 expressed protein 27 8.5 At1g03080.1 68414.m00282 kinase interacting family protein simil... 27 8.5 >At5g57380.1 68418.m07169 fibronectin type III domain-containing protein / PHD finger protein-related contains Pfam profiles PF00041: Fibronectin type III domain, PF00628: PHD-finger Length = 600 Score = 31.1 bits (67), Expect = 0.69 Identities = 16/40 (40%), Positives = 25/40 (62%) Frame = +1 Query: 154 DRDRVECCSSLEQESTIKERGLQRQRAKNRLSGRGPLREP 273 D+D E CS+ E ES ++E L +++A N++ GR L P Sbjct: 434 DKDNTEHCSAGEVESELEEERLVKRKA-NKIDGRDLLVTP 472 >At4g33630.2 68417.m04778 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 420 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 322 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At4g33630.1 68417.m04777 expressed protein Length = 684 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = -3 Query: 420 PSARSFRFLPFLSRHVRRLSPSSSKSGAPFRVP 322 P +++ F P S RL+PSS +S P R+P Sbjct: 7 PPSQNLAFSPAASATSSRLTPSSKRSFYPHRLP 39 >At1g64960.1 68414.m07363 expressed protein Length = 1168 Score = 27.5 bits (58), Expect = 8.5 Identities = 10/16 (62%), Positives = 11/16 (68%) Frame = +1 Query: 301 RCRKALNRNPKGSPRF 348 RCR +NRNPK RF Sbjct: 552 RCRTLINRNPKAGARF 567 >At1g03080.1 68414.m00282 kinase interacting family protein similar to kinase interacting protein 1 (GI:13936326) [Petunia integrifolia] Length = 1744 Score = 27.5 bits (58), Expect = 8.5 Identities = 9/32 (28%), Positives = 21/32 (65%) Frame = +1 Query: 142 IKRIDRDRVECCSSLEQESTIKERGLQRQRAK 237 ++ + + VE C +LE ST+K+R +++ + + Sbjct: 1340 LEGLTNELVEACKNLESRSTLKDREIEQLKGR 1371 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,053,193 Number of Sequences: 28952 Number of extensions: 286279 Number of successful extensions: 572 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 561 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 572 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -