BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0197.Seq (674 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 2e-05 SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 8e-04 SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.023 SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.040 SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.052 SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) 32 0.49 SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) 32 0.49 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) 28 7.9 SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 >SB_59794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 46.8 bits (106), Expect = 2e-05 Identities = 21/24 (87%), Positives = 22/24 (91%) Frame = -2 Query: 412 DVVAVSQAPSPESNPDSPLPVTTM 341 DVVAVSQAPSPESNP+SP PV TM Sbjct: 105 DVVAVSQAPSPESNPNSPSPVVTM 128 >SB_25244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 41.1 bits (92), Expect = 8e-04 Identities = 18/21 (85%), Positives = 19/21 (90%) Frame = -2 Query: 403 AVSQAPSPESNPDSPLPVTTM 341 AVSQAPSPESNP+SP PV TM Sbjct: 52 AVSQAPSPESNPNSPSPVVTM 72 >SB_56793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 36.3 bits (80), Expect = 0.023 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 1 VICLSQRLSHACLSASRIKAIPRMA 75 VICLSQRLSHACLS S RMA Sbjct: 137 VICLSQRLSHACLSISTCTVKLRMA 161 >SB_1371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 35.5 bits (78), Expect = 0.040 Identities = 18/25 (72%), Positives = 18/25 (72%) Frame = +1 Query: 1 VICLSQRLSHACLSASRIKAIPRMA 75 VICLSQRLSHACLS S RMA Sbjct: 113 VICLSQRLSHACLSISTRTVKLRMA 137 >SB_34518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 35.1 bits (77), Expect = 0.052 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 402 PFLRLPLRNRTLIPRYP 352 PFLRLPLRNRTLI R+P Sbjct: 224 PFLRLPLRNRTLILRHP 240 >SB_25694| Best HMM Match : RVT_1 (HMM E-Value=1.9e-22) Length = 1797 Score = 31.9 bits (69), Expect = 0.49 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 2 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 136 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 447 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 491 >SB_15796| Best HMM Match : RVT_1 (HMM E-Value=0.00082) Length = 1304 Score = 31.9 bits (69), Expect = 0.49 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +2 Query: 2 LYACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYLDNCGNS 136 L CL D A+ ++ + +Y W+N+ +LV L ++ CG+S Sbjct: 866 LMTCLYDKAVFLTDEEYAAKYGRWVNVQMLVEEPELHFIAKCGSS 910 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 520 LNILTRNNWRASLXXXXXXXXXXXXYTKIVAVKKL 624 ++++ R +WRASL Y K+VAVKKL Sbjct: 56 MHLVIRIHWRASLVPAAAVIPAPIAYIKVVAVKKL 90 >SB_42465| Best HMM Match : 2-oxoacid_dh (HMM E-Value=0) Length = 441 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -2 Query: 421 PSLDVVAVSQAPSPESNPDSPLP 353 P+ DV+A Q P P S D PLP Sbjct: 75 PAEDVMAAHQEPKPTSAIDQPLP 97 >SB_18079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +1 Query: 535 RNNWRASLXXXXXXXXXXXXYTKIVAVKKL 624 R +WRASL Y K+VAVKKL Sbjct: 14 RIHWRASLVPAAAVIPAPIAYIKVVAVKKL 43 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,346,627 Number of Sequences: 59808 Number of extensions: 427301 Number of successful extensions: 1115 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1115 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -