BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0196.Seq (728 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000660422 Cluster: fibronectin type III domain cont... 34 4.1 UniRef50_Q9FBG9 Cluster: BlpU protein; n=13; Streptococcus|Rep: ... 33 9.5 >UniRef50_UPI0000660422 Cluster: fibronectin type III domain containing 7; n=1; Takifugu rubripes|Rep: fibronectin type III domain containing 7 - Takifugu rubripes Length = 3263 Score = 33.9 bits (74), Expect = 4.1 Identities = 19/60 (31%), Positives = 32/60 (53%) Frame = +1 Query: 400 LNCATNSTTLSPEPRANLRYLLHRLLSAFNRHQRSQFKRTNNSRRISHLKCGAAYKGSLT 579 L C TN+ S P + + Y + SAF+ +N+S IS+L+CG +Y+ ++T Sbjct: 1737 LECDTNTAVASWTPGSGILYY-NASASAFSFTHVQSCSTSNSSCNISNLQCGESYRVTVT 1795 >UniRef50_Q9FBG9 Cluster: BlpU protein; n=13; Streptococcus|Rep: BlpU protein - Streptococcus pneumoniae Length = 76 Score = 32.7 bits (71), Expect = 9.5 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 453 QVRTWFWAECGAVGGAVQS--VYHRCCWW 373 + RTW A GAVGGA+ Y CWW Sbjct: 48 KTRTWQGAATGAVGGAILGGVAYAATCWW 76 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 570,143,843 Number of Sequences: 1657284 Number of extensions: 8942549 Number of successful extensions: 23730 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22986 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23715 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 58853922985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -