BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0196.Seq (728 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 26 0.36 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 26 0.36 U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 22 4.4 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 5.8 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 7.7 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 21 7.7 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 25.8 bits (54), Expect = 0.36 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 314 NARLSGYLQPYSPTYLVPQHHQQHLWY 394 N + ++Q P + P H QQH+ Y Sbjct: 164 NHHMGHHMQEQHPQHHQPHHQQQHMMY 190 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 25.8 bits (54), Expect = 0.36 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +2 Query: 314 NARLSGYLQPYSPTYLVPQHHQQHLWY 394 N + ++Q P + P H QQH+ Y Sbjct: 166 NHHMGHHMQEQHPQHHQPHHQQQHMMY 192 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 427 VWCCWWRSSVGVPQVLLVVLRHEVRGGVGLK 335 V CCW +S + +PQ +L + + GLK Sbjct: 11 VACCWGKS-LSIPQQILNEFKSTLLPLFGLK 40 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 5.8 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = +3 Query: 396 PTELRHQQHHTQPRTTCELAISPPPTSI 479 PT L+ T P +C+ A S T + Sbjct: 83 PTHLQSPNTQTHPSASCKYADSTSSTGV 110 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 7.7 Identities = 5/13 (38%), Positives = 11/13 (84%) Frame = +1 Query: 223 RLRYTFPPITIHG 261 +++ FPP+++HG Sbjct: 289 KIKKAFPPLSLHG 301 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.4 bits (43), Expect = 7.7 Identities = 9/23 (39%), Positives = 10/23 (43%) Frame = -3 Query: 249 DRWERITEAGGIQATLRLPGTAR 181 D W+ T GG T L G R Sbjct: 118 DVWQSATSGGGANLTNSLTGPVR 140 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,153 Number of Sequences: 336 Number of extensions: 2271 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19467635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -