BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0187.Seq (590 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18947| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_12424| Best HMM Match : LEH (HMM E-Value=9.7) 27 8.7 >SB_18947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = +3 Query: 291 PAPHSTPTCCSALRSPRRISGNHRRCRP 374 P P +TPT C+ R+SG RR RP Sbjct: 3 PIPTTTPTPCAGTLPSTRLSGATRRPRP 30 >SB_12424| Best HMM Match : LEH (HMM E-Value=9.7) Length = 173 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/37 (27%), Positives = 24/37 (64%) Frame = +1 Query: 409 ASLREGIQGQDGRVPTSGRAVPTLSG*LNAWCILIRT 519 +S R G+QG++G ++ ++ +L+ L+ W + I++ Sbjct: 6 SSSRRGVQGREGGAYSNHSSIHSLAQPLSVWLVFIKS 42 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,574,077 Number of Sequences: 59808 Number of extensions: 336453 Number of successful extensions: 972 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 864 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 972 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -