BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0185X.Seq (623 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 26 0.29 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 1.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 25.8 bits (54), Expect = 0.29 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = -1 Query: 200 WASSPT*ESFWPIPTITPWWRGRPTMDGKTAR 105 W + P+ ++W T +PWW T T R Sbjct: 1035 WTTKPS--TWWSSTTTSPWWTTTTTRRTTTTR 1064 Score = 21.0 bits (42), Expect = 8.4 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = -1 Query: 200 WASSPT*ESFWPIPTITPWWRGRPTMDGKTAR 105 W SS T +W T RPT T R Sbjct: 1042 WWSSTTTSPWWTTTTTRRTTTTRPTTTSTTTR 1073 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.4 bits (48), Expect = 1.6 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = +2 Query: 503 PHVPIYEGYALPHAILRLDLAGRDFTDYLMKILTEKG 613 PH +Y+ H I LD D TD M + G Sbjct: 203 PHAKLYDYDLSSHVITILDWTKEDGTDKFMSHIHNDG 239 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 140,813 Number of Sequences: 336 Number of extensions: 2983 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15979473 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -