BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0184.Seq (710 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 pro... 125 2e-30 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 26 1.0 CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein... 24 5.4 CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. 24 5.4 DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doub... 23 7.2 AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal ... 23 7.2 AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-b... 23 7.2 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 23 9.5 >AJ439353-12|CAD27934.1| 160|Anopheles gambiae putative MLC1 protein protein. Length = 160 Score = 125 bits (301), Expect = 2e-30 Identities = 56/75 (74%), Positives = 65/75 (86%) Frame = +2 Query: 251 KEDKDQGAYEDFLECLKLYDKNENGLMLGAELTHTLLALGEKLDDSEVAEVTKDCMDPED 430 K++K+QG +EDFLECLKLYDKNE+G ML AELTH+L ALGE+LDD E+ V KDCMDPED Sbjct: 76 KKEKEQGCFEDFLECLKLYDKNEDGTMLLAELTHSLTALGERLDDVELDNVMKDCMDPED 135 Query: 431 DDGMIPYAAFLKKVM 475 DDG IPYA FLKK+M Sbjct: 136 DDGNIPYAPFLKKMM 150 Score = 71.7 bits (168), Expect = 2e-14 Identities = 34/77 (44%), Positives = 46/77 (59%) Frame = +3 Query: 33 SDLSKNDVERASFAFSIYDFEGKGKIDAFNLGDLLRALNSNPTLATIXXXXXXXXXXXXX 212 +DL ++E+A F FS+YD+EG G++DA +LG+ LRALN NPT+ I Sbjct: 3 NDLKDVEIEKAQFVFSVYDWEGSGQMDAMDLGNALRALNLNPTIELIGKMGGTQKRGEKK 62 Query: 213 XXXXXFLPIYSQAKKTK 263 FLPI+SQ KK K Sbjct: 63 IKFEEFLPIFSQVKKEK 79 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.2 bits (55), Expect = 1.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 368 GEKLDDSEVAEVTKDCMDPEDDDG 439 G K+++ +AEV K +D EDD G Sbjct: 1250 GLKMENGVIAEVEKSQVDGEDDTG 1273 Score = 23.0 bits (47), Expect = 9.5 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 401 LQRLHCRQASHLVQEACV*AQRQA*DRFRSCHTASD 294 ++RL C + LV+E +R+ DRF H S+ Sbjct: 1783 IKRLSCAEICQLVKERARAKRREDVDRFDLQHADSN 1818 >CR954257-15|CAJ14166.1| 271|Anopheles gambiae predicted protein protein. Length = 271 Score = 23.8 bits (49), Expect = 5.4 Identities = 20/74 (27%), Positives = 34/74 (45%) Frame = +2 Query: 185 WYKEEGREAAHTRRVPSHLQPSKEDKDQGAYEDFLECLKLYDKNENGLMLGAELTHTLLA 364 + +E G+ + T + S+ED++ A DFL+ K D + G L E T Sbjct: 86 YQQERGKGRSMTDLRLAGYGSSEEDENLRAPRDFLDAGKPNDLQQEGETLNKEPVET--- 142 Query: 365 LGEKLDDSEVAEVT 406 ++ + E+ EVT Sbjct: 143 KPQESEPPEMQEVT 156 >CR954256-3|CAJ14144.1| 659|Anopheles gambiae cyclin protein. Length = 659 Score = 23.8 bits (49), Expect = 5.4 Identities = 13/54 (24%), Positives = 26/54 (48%) Frame = +1 Query: 106 RSMPSTLAIS*ERSTQTPHWQPSRNSVVQRRRARSCSHSKSSFPSTAKQRRQRP 267 R++P T + + P + R ++ + RR R ++ + P+T + R RP Sbjct: 475 RTIPPTRVAA---AAAAPEGRRRRRAIARARRRRCRPRARRNPPATTRPVRHRP 525 >DQ137801-1|AAZ78362.1| 622|Anopheles gambiae male-specific doublesex protein protein. Length = 622 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = +2 Query: 233 SHLQPSKEDKDQGAYEDFLECLKLYDKN 316 +H P +ED YE +LE ++ K+ Sbjct: 412 THKSPEREDNPSQPYEAYLESVRRSKKS 439 >AY187043-1|AAO39757.1| 171|Anopheles gambiae putative antennal carrier protein AP-1 protein. Length = 171 Score = 23.4 bits (48), Expect = 7.2 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +2 Query: 338 AELTHTLLALGEKLDDSEVAEVTKDCMDP 424 AE ++ DD +VT++C+DP Sbjct: 64 AESFKCVIVKNSTKDDVNKVQVTRECLDP 92 >AJ697727-1|CAG26920.1| 285|Anopheles gambiae putative odorant-binding protein OBPjj17 protein. Length = 285 Score = 23.4 bits (48), Expect = 7.2 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -2 Query: 385 VVKLLT*CKKRVCELSAKHETVFVLVIQLQTFQEIF 278 V+K L+ CK +V +L +H + Q + ++IF Sbjct: 130 VLKALSYCKPKVTQLQGRHVRTDEEMEQCEIAEDIF 165 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 23.0 bits (47), Expect = 9.5 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = +2 Query: 332 LGAELTH---TLLALGEKLDDSEVAEVTKDCM 418 LG EL T + LG+ DSE A+ T CM Sbjct: 35 LGGELPEDFATKMRLGDLTLDSETAKCTIQCM 66 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 633,393 Number of Sequences: 2352 Number of extensions: 11024 Number of successful extensions: 50 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 46 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 49 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72758970 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -