BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0178.Seq (732 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 33 0.002 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 33 0.002 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 33 0.002 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 25 0.63 AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase ... 24 1.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 24 1.5 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 24 1.5 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 24 1.5 U77974-1|AAB36556.1| 276|Tribolium castaneum transcription fact... 23 1.9 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.4 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 33.5 bits (73), Expect = 0.002 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +3 Query: 432 APSRRPRCAPTSASCRKTRCSSTTPLIQHSIRKIERARR*YNICR-QERGHSRPNTDVSR 608 A R P+ P AS + S ++P +HSI +E + N+CR + ++RP+T + Sbjct: 209 ADFRPPQETPVLASYKSVPMSFSSPRRRHSINLLEEDNQKPNVCRICGKSYARPSTLKTH 268 Query: 609 RLRHAG 626 H+G Sbjct: 269 LRTHSG 274 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 33.5 bits (73), Expect = 0.002 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 646 LSGGEKQRIAIARTILKDPAIVLLDEATS 732 +SGGEK+R++ A +L +P ++ DE TS Sbjct: 220 ISGGEKKRLSFAAEVLTNPKLMFCDEPTS 248 Score = 29.5 bits (63), Expect = 0.029 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 281 VLNNISFKIAPGSTVALVGPIGAGKSTIMRLL 376 +L N+ PG +A++G GAGK+T++ L Sbjct: 93 ILKNVFGVAYPGELLAILGSSGAGKTTLLNTL 124 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 33.5 bits (73), Expect = 0.002 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +1 Query: 646 LSGGEKQRIAIARTILKDPAIVLLDEATS 732 +SGGEK+R++ A +L +P ++ DE TS Sbjct: 220 ISGGEKKRLSFAAEVLTNPKLMFCDEPTS 248 Score = 29.5 bits (63), Expect = 0.029 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 281 VLNNISFKIAPGSTVALVGPIGAGKSTIMRLL 376 +L N+ PG +A++G GAGK+T++ L Sbjct: 93 ILKNVFGVAYPGELLAILGSSGAGKTTLLNTL 124 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 25.0 bits (52), Expect = 0.63 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 241 STPPRRTTSSGAPAASRTSVS 179 + PP TTSSG+PA+ ++ S Sbjct: 32 AAPPPATTSSGSPASVASNAS 52 >AY362544-1|AAQ63456.1| 268|Tribolium castaneum chitin synthase protein. Length = 268 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -3 Query: 538 RSIFRIEC--CINGVVEEHRVLRHD 470 +S+FR++ C + +V EH L+HD Sbjct: 7 KSVFRLDQDQCSHRIVREHLGLKHD 31 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -3 Query: 538 RSIFRIEC--CINGVVEEHRVLRHD 470 +S+FR++ C + +V EH L+HD Sbjct: 321 KSVFRLDQDQCSHRIVREHLGLKHD 345 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -3 Query: 538 RSIFRIEC--CINGVVEEHRVLRHD 470 +S+FR++ C + +V EH L+HD Sbjct: 554 KSVFRLDQDQCSHRIVREHLGLKHD 578 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/25 (40%), Positives = 17/25 (68%), Gaps = 2/25 (8%) Frame = -3 Query: 538 RSIFRIEC--CINGVVEEHRVLRHD 470 +S+FR++ C + +V EH L+HD Sbjct: 554 KSVFRLDQDQCSHRIVREHLGLKHD 578 >U77974-1|AAB36556.1| 276|Tribolium castaneum transcription factor homolog protein. Length = 276 Score = 23.4 bits (48), Expect = 1.9 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 252 VPSDTAPRGSSLTTSVLKSPPEAPL 326 VP+ ++PR S + + V SP PL Sbjct: 223 VPTKSSPRSSPVQSDVSLSPVHEPL 247 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.4 Identities = 14/45 (31%), Positives = 20/45 (44%) Frame = +3 Query: 228 RGGVEFKHVPSDTAPRGSSLTTSVLKSPPEAPLHWSGPSARENRR 362 R G E + + R SLT PP PL+ S P + ++R Sbjct: 805 RSGSESSSISERCSSRVESLTPERKMEPPGVPLN-STPRSTPDKR 848 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -1 Query: 336 PTNATVLPGAIL 301 PTNA PGAIL Sbjct: 1026 PTNAGTTPGAIL 1037 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,287 Number of Sequences: 336 Number of extensions: 3226 Number of successful extensions: 15 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19571740 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -