BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0173X.Seq (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 6e-10 SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 7e-08 SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 3e-07 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.92 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 29 4.9 SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.5 SB_3565| Best HMM Match : ASC (HMM E-Value=1.1e-12) 28 6.5 SB_15223| Best HMM Match : ASC (HMM E-Value=1.8e-19) 28 6.5 SB_595| Best HMM Match : CH (HMM E-Value=0) 28 6.5 >SB_17617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 61.7 bits (143), Expect = 6e-10 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 113 SWIVARRTSAKAFAKGVFINQERKLEVRRRLDTALVL 3 SWI RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 4 SWIYERRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40 >SB_57691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 98 RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 3 RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40 >SB_6465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 98 RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 3 RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40 >SB_2383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 98 RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 3 RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 9 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 40 >SB_27342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 54.8 bits (126), Expect = 7e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 98 RRTSAKAFAKGVFINQERKLEVRRRLDTALVL 3 RRT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 11 RRTTAKAFAKNVFINQERKLEDRRRSDTVLVL 42 >SB_58054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 52.8 bits (121), Expect = 3e-07 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -2 Query: 95 RTSAKAFAKGVFINQERKLEVRRRLDTALVL 3 RT+AKAFAK VFINQERKLE RRR DT LVL Sbjct: 29 RTTAKAFAKNVFINQERKLEDRRRSDTVLVL 59 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 8e-06 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -2 Query: 95 RTSAKAFAKGVFINQERKLEVRRRLDT 15 RT+AKAFAK VFINQERKLE RRR DT Sbjct: 2 RTTAKAFAKNVFINQERKLEDRRRSDT 28 >SB_33624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 42.3 bits (95), Expect = 4e-04 Identities = 22/33 (66%), Positives = 26/33 (78%), Gaps = 1/33 (3%) Frame = -2 Query: 98 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 3 R+T+ ++ AK VFINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESIAKNVFINQERKLEDRRRSDTVLVL 40 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -1 Query: 120 VKFLDRRKTNISESICQRCFHQSRTKV 40 VKFLD RKTN ESI + F K+ Sbjct: 2 VKFLDLRKTNYCESIAKNVFINQERKL 28 >SB_6881| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 38.7 bits (86), Expect = 0.005 Identities = 20/33 (60%), Positives = 25/33 (75%), Gaps = 1/33 (3%) Frame = -2 Query: 98 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 3 R+T+ ++ + VFINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESICQDVFINQERKLEDRRRSDTVLVL 40 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/27 (59%), Positives = 17/27 (62%) Frame = -1 Query: 120 VKFLDRRKTNISESICQRCFHQSRTKV 40 VKFLD RKTN ESICQ F K+ Sbjct: 2 VKFLDLRKTNYCESICQDVFINQERKL 28 >SB_1546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -1 Query: 120 VKFLDRRKTNISESICQRCFHQSRTKV 40 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -2 Query: 98 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 3 R+T+ ++ + FINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVL 40 >SB_13730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 38.7 bits (86), Expect = 0.005 Identities = 17/27 (62%), Positives = 18/27 (66%) Frame = -1 Query: 120 VKFLDRRKTNISESICQRCFHQSRTKV 40 VKFLD RKTN ESICQ CF K+ Sbjct: 2 VKFLDLRKTNYCESICQECFINQERKL 28 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -2 Query: 98 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 3 R+T+ ++ + FINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVL 40 >SB_26327| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 36.3 bits (80), Expect = 0.025 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -2 Query: 98 RRTS-AKAFAKGVFINQERKLEVRRRLDTALVL 3 R+T+ ++ + FINQERKLE RRR DT LVL Sbjct: 8 RKTNYCESICQECFINQERKLEDRRRSDTVLVL 40 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -1 Query: 117 KFLDRRKTNISESICQRCFHQSRTKV 40 + L RKTN ESICQ CF K+ Sbjct: 3 EILGFRKTNYCESICQECFINQERKL 28 >SB_21059| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1024 Score = 31.1 bits (67), Expect = 0.92 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +2 Query: 182 KTNKIEPRSYSIIPCTKYSSSIFSRFEHSNLFKVKLSAHL 301 K + ++ Y+ + +S F RFEH+N ++KL+ ++ Sbjct: 725 KNHSVDKHDYNNVTPLLFSQERFERFEHNNSLEIKLTVNI 764 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 28.7 bits (61), Expect = 4.9 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -3 Query: 694 RRGSL-EKRLPHPGKPAGAQITHSRHGELVTKNNDTGLLRGLVIGMSTL 551 RR SL + HPG P GA++TH V +N LR GM+ + Sbjct: 431 RRSSLVHSPIQHPGPP-GAKLTHEDERAQVQHSNSCNSLRNEKDGMTKM 478 >SB_40873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2496 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +1 Query: 472 SIRYWSWNYRGCCTRLALQLFLVKIFKVYS 561 S+R W + +R C + LA QLF V + + S Sbjct: 1135 SLRLWGYKWRKCDSTLAKQLFSVLVQAILS 1164 >SB_3565| Best HMM Match : ASC (HMM E-Value=1.1e-12) Length = 575 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 206 SYSIIPCTKYSSSIFSRFEH 265 +Y IPCT Y+ +++SRF H Sbjct: 127 TYRGIPCTNYTENLWSRFWH 146 >SB_15223| Best HMM Match : ASC (HMM E-Value=1.8e-19) Length = 605 Score = 28.3 bits (60), Expect = 6.5 Identities = 10/20 (50%), Positives = 15/20 (75%) Frame = +2 Query: 206 SYSIIPCTKYSSSIFSRFEH 265 +Y IPCT Y+ +++SRF H Sbjct: 58 TYRGIPCTNYTENLWSRFWH 77 >SB_595| Best HMM Match : CH (HMM E-Value=0) Length = 905 Score = 28.3 bits (60), Expect = 6.5 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -1 Query: 696 SGEGALRNGYHIQESQQA--RKLPTPGT 619 S G +++GY+ + QQA RK+P PG+ Sbjct: 331 SNRGTIQSGYYFCKQQQAARRKIPKPGS 358 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,650,657 Number of Sequences: 59808 Number of extensions: 413003 Number of successful extensions: 989 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 910 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 989 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -