BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0173X.Seq (711 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 23 2.2 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 23 2.2 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 23 2.2 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 23 2.2 AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc fi... 23 2.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.0 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 22 5.0 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 21 8.7 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 21 8.7 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 21 8.7 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 21 8.7 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 21 8.7 AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 21 8.7 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 442 NYELFNRNNFSIRYWSWNYRGCCTRL 519 N + N NN+ Y + NY C +L Sbjct: 87 NRTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 442 NYELFNRNNFSIRYWSWNYRGCCTRL 519 N + N NN+ Y + NY C +L Sbjct: 87 NKTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 442 NYELFNRNNFSIRYWSWNYRGCCTRL 519 N + N NN+ Y + NY C +L Sbjct: 87 NKTIHNNNNYKYNYNNNNYNNNCKKL 112 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 23.4 bits (48), Expect = 2.2 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 442 NYELFNRNNFSIRYWSWNYRGCCTRL 519 N + N NN+ Y + NY C +L Sbjct: 87 NKTIHNNNNYKYNYNNNNYNNNCKKL 112 >AB208108-1|BAE72140.1| 92|Apis mellifera Broad complex zinc finger domain-Z3 isoform protein. Length = 92 Score = 23.4 bits (48), Expect = 2.2 Identities = 13/44 (29%), Positives = 26/44 (59%), Gaps = 2/44 (4%) Frame = -1 Query: 129 SLEVKFLDRRKTNISESICQRCFHQSRTK--VRGSKAIRYRPSS 4 SL+ F D+ + + + +C+ C + RTK + K++++R SS Sbjct: 20 SLKRHFQDKHEQSDTLYVCEFCNRRYRTKNSLTTHKSLQHRGSS 63 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -1 Query: 105 RRKTNISESICQRCFHQ 55 RR+ N++E++C F Q Sbjct: 966 RRRLNVNETVCSDYFSQ 982 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 22.2 bits (45), Expect = 5.0 Identities = 9/27 (33%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 442 NYEL-FNRNNFSIRYWSWNYRGCCTRL 519 NY+ +N NN++ ++ NY C +L Sbjct: 328 NYKYNYNNNNYNNNNYNNNYNNNCKKL 354 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 424 SAAHKCNYELFNRNNFSIRYWSWNY 498 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 424 SAAHKCNYELFNRNNFSIRYWSWNY 498 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 424 SAAHKCNYELFNRNNFSIRYWSWNY 498 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 424 SAAHKCNYELFNRNNFSIRYWSWNY 498 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 8.7 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +1 Query: 424 SAAHKCNYELFNRNNFSIRYWSWNY 498 S ++ NY +N NN+ ++ NY Sbjct: 84 SLSNNYNYSNYNNNNYKQLCYNINY 108 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 21.4 bits (43), Expect = 8.7 Identities = 14/42 (33%), Positives = 18/42 (42%) Frame = +1 Query: 490 WNYRGCCTRLALQLFLVKIFKVYSFRLRGLVRVPYRYFSSLT 615 WN LA+ LFL + V+ L L V RY + T Sbjct: 39 WNLATDRAGLAILLFLFSVATVFGNTLVILAVVRERYLHTAT 80 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,716 Number of Sequences: 438 Number of extensions: 4629 Number of successful extensions: 16 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21926700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -