BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0173X.Seq (711 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g14470.1 68414.m01716 pentatricopeptide (PPR) repeat-containi... 28 5.3 At3g28040.1 68416.m03500 leucine-rich repeat transmembrane prote... 28 7.0 At4g10890.1 68417.m01772 expressed protein 27 9.3 >At1g14470.1 68414.m01716 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 540 Score = 28.3 bits (60), Expect = 5.3 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 2/74 (2%) Frame = +1 Query: 397 SITADACTDSAAHKCNYELFNRNNFSIR-YWSWNYRGCCTRLALQLFLVK-IFKVYSFRL 570 +I + A T ++ + +L N+ + YW+ CCTRL + + IF +F Sbjct: 11 AIASQALTFPQLNQIHAQLIVFNSLPRQSYWASRIISCCTRLRAPSYYTRLIFDSVTFPN 70 Query: 571 RGLVRVPYRYFSSL 612 +V ++YFS + Sbjct: 71 VFVVNSMFKYFSKM 84 >At3g28040.1 68416.m03500 leucine-rich repeat transmembrane protein kinase, putative contains Pfam profiles: PF00560 leucine rich repeat, PF00069 eukaryotic protein kinase domain Length = 1016 Score = 27.9 bits (59), Expect = 7.0 Identities = 11/20 (55%), Positives = 15/20 (75%) Frame = +2 Query: 515 DLPSNCSSLKYLKCTHSDYE 574 DL +NCSSL+YL +H+ E Sbjct: 167 DLFNNCSSLRYLSLSHNHLE 186 >At4g10890.1 68417.m01772 expressed protein Length = 527 Score = 27.5 bits (58), Expect = 9.3 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -1 Query: 102 RKTNISESICQRCFHQS-RTKVRGSKAIRYRPSSN 1 ++T I +C RC+H S R K+R S R S++ Sbjct: 194 KQTKICSRVCSRCYHYSMRQKLRHSLHTRILKSNS 228 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,230,690 Number of Sequences: 28952 Number of extensions: 275557 Number of successful extensions: 588 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 574 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1535986264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -