BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0172.Seq (727 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0687 - 5651002-5651453,5651535-5651951,5652621-5653338,565... 36 0.033 10_08_0095 + 14760292-14760624,14760689-14761000,14761768-147624... 36 0.033 04_01_0222 - 2805329-2805780,2805866-2806611,2806730-2806778,280... 36 0.033 03_05_0361 - 23448459-23448910,23448990-23449406,23449542-234497... 36 0.033 01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 34 0.100 01_07_0082 - 40965947-40967023 33 0.17 01_01_0083 + 631196-631675 33 0.17 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 33 0.31 11_03_0112 - 10135052-10135168,10135712-10135795,10135879-101359... 32 0.40 11_04_0319 - 16348349-16348591,16348818-16349066,16349827-16349832 32 0.53 08_02_1019 - 23657175-23658047 32 0.53 03_05_0663 + 26546810-26547304 31 0.70 05_02_0161 + 7199005-7199505,7200118-7200378,7201532-7201621 31 0.93 04_04_0578 + 26353830-26353929,26354030-26354277,26354539-26354931 31 0.93 07_03_1136 + 24218601-24218734,24218769-24219906 31 1.2 06_01_0493 - 3536207-3537056,3537603-3537826,3538234-3538503,353... 31 1.2 09_04_0377 + 17086775-17088310 30 1.6 06_01_0172 + 1362101-1363708 30 1.6 07_03_1267 + 25318220-25318407,25318674-25318844,25319086-253191... 30 2.2 04_01_0162 + 1845295-1846317,1846430-1846565,1848436-1848626,184... 30 2.2 11_06_0283 + 21905706-21905835,21906059-21906132 29 2.8 01_06_0837 - 32328191-32328369,32328682-32328731,32328844-323289... 29 2.8 01_05_0173 + 18916930-18917324,18917542-18917638 29 2.8 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 29 2.8 06_01_0738 + 5458182-5458374,5460512-5461766,5461861-5462053,546... 29 3.8 04_04_0260 + 23996775-23996865,23997031-23997566,23998407-239988... 29 3.8 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 29 5.0 12_02_0998 + 25126114-25126596,25129213-25129339,25129349-251294... 28 6.6 07_03_1767 + 29338867-29338912,29339261-29339325,29339571-293396... 28 6.6 03_06_0485 + 34242121-34243188 28 6.6 02_03_0101 + 15233783-15234601 28 6.6 11_04_0355 + 16705281-16706006 28 8.7 10_08_0551 + 18702081-18702251,18702328-18702424,18702533-187026... 28 8.7 07_03_0039 - 12718972-12720699 28 8.7 06_02_0127 + 12140843-12140966,12141170-12141567 28 8.7 06_02_0126 + 12130409-12130532,12131015-12131373 28 8.7 05_04_0114 + 18090593-18092248 28 8.7 05_03_0604 - 16132173-16132391,16132488-16132556,16132824-161328... 28 8.7 01_05_0791 + 25267885-25267930,25268258-25268713,25268802-252688... 28 8.7 >11_01_0687 - 5651002-5651453,5651535-5651951,5652621-5653338, 5654106-5654417,5654482-5654814 Length = 743 Score = 35.9 bits (79), Expect = 0.033 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +3 Query: 513 YGGNVPPPSG--GYGGNVPPPSGGAG 584 YG PPP+G GYGG VPPP+ G Sbjct: 424 YGVGAPPPTGQQGYGGGVPPPTCSGG 449 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/17 (70%), Positives = 13/17 (76%), Gaps = 2/17 (11%) Frame = +3 Query: 510 GYGGNVPPP--SGGYGG 554 GYGG VPPP SGG+ G Sbjct: 436 GYGGGVPPPTCSGGHTG 452 >10_08_0095 + 14760292-14760624,14760689-14761000,14761768-14762489, 14762905-14763187,14763419-14763650,14763736-14764187 Length = 777 Score = 35.9 bits (79), Expect = 0.033 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +3 Query: 513 YGGNVPPPSG--GYGGNVPPPSGGAG 584 YG PPP+G GYGG VPPP+ G Sbjct: 424 YGVGAPPPTGQQGYGGGVPPPTCSGG 449 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/17 (70%), Positives = 13/17 (76%), Gaps = 2/17 (11%) Frame = +3 Query: 510 GYGGNVPPP--SGGYGG 554 GYGG VPPP SGG+ G Sbjct: 436 GYGGGVPPPTCSGGHTG 452 >04_01_0222 - 2805329-2805780,2805866-2806611,2806730-2806778, 2807031-2807748,2808513-2808824 Length = 758 Score = 35.9 bits (79), Expect = 0.033 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +3 Query: 513 YGGNVPPPSG--GYGGNVPPPSGGAG 584 YG PPP+G GYGG VPPP+ G Sbjct: 313 YGVGAPPPTGQQGYGGGVPPPTCSGG 338 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/17 (70%), Positives = 13/17 (76%), Gaps = 2/17 (11%) Frame = +3 Query: 510 GYGGNVPPP--SGGYGG 554 GYGG VPPP SGG+ G Sbjct: 325 GYGGGVPPPTCSGGHTG 341 >03_05_0361 - 23448459-23448910,23448990-23449406,23449542-23449735, 23449854-23449902,23450155-23450539,23450578-23450874, 23451650-23451961 Length = 701 Score = 35.9 bits (79), Expect = 0.033 Identities = 15/26 (57%), Positives = 17/26 (65%), Gaps = 2/26 (7%) Frame = +3 Query: 513 YGGNVPPPSG--GYGGNVPPPSGGAG 584 YG PPP+G GYGG VPPP+ G Sbjct: 301 YGVGAPPPTGQQGYGGGVPPPTCSGG 326 >01_01_0716 - 5548908-5549235,5549327-5549768,5549847-5549982 Length = 301 Score = 34.3 bits (75), Expect = 0.100 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +3 Query: 510 GYGGN---VPPPSGGYGGNVPPPSGGAGIW 590 GYG + P P GGYGG P PS G G + Sbjct: 115 GYGASPPVTPSPGGGYGGGSPAPSHGGGAY 144 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/26 (53%), Positives = 15/26 (57%), Gaps = 3/26 (11%) Frame = +3 Query: 510 GYGGNVPPPS---GGYGGNVPPPSGG 578 GYGG P PS G YG + PSGG Sbjct: 129 GYGGGSPAPSHGGGAYGSSPSTPSGG 154 >01_07_0082 - 40965947-40967023 Length = 358 Score = 33.5 bits (73), Expect = 0.17 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGAG 584 GY PPP GYG PPP G G Sbjct: 263 GYPAQPPPPQAGYGYPPPPPQAGYG 287 Score = 31.5 bits (68), Expect = 0.70 Identities = 14/26 (53%), Positives = 14/26 (53%), Gaps = 1/26 (3%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVP-PPSGGAG 584 GYG PPP GYGG PP G G Sbjct: 274 GYGYPPPPPQAGYGGGYGYPPQAGYG 299 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/24 (50%), Positives = 12/24 (50%), Gaps = 2/24 (8%) Frame = +3 Query: 519 GNVPPPSGGYG--GNVPPPSGGAG 584 G PPP GYG PPP G G Sbjct: 253 GTAPPPQYGYGYPAQPPPPQAGYG 276 >01_01_0083 + 631196-631675 Length = 159 Score = 33.5 bits (73), Expect = 0.17 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 3/24 (12%) Frame = +3 Query: 522 NVPPPSGGYGGNVP---PPSGGAG 584 N PPP GG GG +P PP+GG G Sbjct: 76 NYPPPQGGGGGYIPYYQPPAGGGG 99 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 504 P*GYGGNVPPPSGGYGGNVPPPSGGAGIWV 593 P N PP S Y N PPP GG G ++ Sbjct: 60 PSSSSSNTPPSSSSY-WNYPPPQGGGGGYI 88 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 32.7 bits (71), Expect = 0.31 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = +3 Query: 495 PWLP*GYGGNVPPPSGGYGGNVPPPSGGAGI 587 P +P G G PPP GG G +P P GG G+ Sbjct: 1207 PPMPPGVPGGPPPPPGGRG--LPAPPGGRGV 1235 Score = 31.1 bits (67), Expect = 0.93 Identities = 17/30 (56%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = +3 Query: 495 PWLP*GYGG-NVPPPSGGYGG-NVPPPSGG 578 P LP G GG PPP GG GG PPP G Sbjct: 1139 PPLPEGIGGVPPPPPVGGLGGPPAPPPPAG 1168 Score = 30.7 bits (66), Expect = 1.2 Identities = 12/27 (44%), Positives = 15/27 (55%), Gaps = 1/27 (3%) Frame = +3 Query: 510 GYGGN-VPPPSGGYGGNVPPPSGGAGI 587 G GG PPP G+ G PPP+ G+ Sbjct: 1156 GLGGPPAPPPPAGFRGGTPPPNAHGGV 1182 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/30 (43%), Positives = 16/30 (53%), Gaps = 2/30 (6%) Frame = +3 Query: 504 P*GYGGNVPPPS--GGYGGNVPPPSGGAGI 587 P G+ G PPP+ GG PPP G G+ Sbjct: 1166 PAGFRGGTPPPNAHGGVAPPPPPPRGHGGV 1195 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +3 Query: 525 VPPPSGGYGGNVPPPSGGAG 584 +PP G YG PPPS GAG Sbjct: 1088 LPPTLGDYGVAPPPPSIGAG 1107 Score = 27.9 bits (59), Expect = 8.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 516 GGNVPPPSGGYGGNVPPPSGGAGI 587 G PP G G PPP GG G+ Sbjct: 1203 GAPAPPMPPGVPGGPPPPPGGRGL 1226 >11_03_0112 - 10135052-10135168,10135712-10135795,10135879-10135953, 10137801-10137978,10138048-10138212,10138291-10138337, 10140233-10140301,10140531-10140629,10141256-10141375, 10141459-10141581,10149251-10149364,10150725-10150913, 10151058-10151110,10151365-10151470,10151957-10152085 Length = 555 Score = 32.3 bits (70), Expect = 0.40 Identities = 21/61 (34%), Positives = 26/61 (42%) Frame = -2 Query: 501 ARGCCVQCSCYRCSRWHFDFPGACGTPACADSDVVNWERFGIRPRYEWNSFTLASSGDNS 322 AR CC + RC W + G G + DV + + YE SF A SG NS Sbjct: 37 ARDCCAKPK-KRCVDWIGEGGGLGGMEEYIEEDVGTCSAWNLEANYEVVSFIYAFSGINS 95 Query: 321 A 319 A Sbjct: 96 A 96 >11_04_0319 - 16348349-16348591,16348818-16349066,16349827-16349832 Length = 165 Score = 31.9 bits (69), Expect = 0.53 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = +3 Query: 516 GGNVPPPSGGYGGNVPPPSG 575 GG VPPPS G + PPPSG Sbjct: 38 GGVVPPPSLARGDSAPPPSG 57 >08_02_1019 - 23657175-23658047 Length = 290 Score = 31.9 bits (69), Expect = 0.53 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGAG 584 GY + P GG GG VP P GG G Sbjct: 23 GYDAPMQPGLGGGGGGVPKPGGGVG 47 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGAG 584 G GG VP P GG GG GG G Sbjct: 34 GGGGGVPKPGGGVGGGGGGGGGGGG 58 >03_05_0663 + 26546810-26547304 Length = 164 Score = 31.5 bits (68), Expect = 0.70 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 489 STPWLP*GYGG-NVPPPSGGYGGNVPPPSGG 578 S P + G GG NVP GG+GG PSGG Sbjct: 72 SIPGMGGGMGGFNVPGMGGGWGGGYGTPSGG 102 >05_02_0161 + 7199005-7199505,7200118-7200378,7201532-7201621 Length = 283 Score = 31.1 bits (67), Expect = 0.93 Identities = 17/57 (29%), Positives = 19/57 (33%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGAGIWVDXXXXXXXXXXXXXXXDCSGEASVCGSCG 680 G G++PPP GG PPP G V D G A V G Sbjct: 44 GVDGDLPPPPPDDGGEFPPPPDDGGEGVSEGGAGVAGPPEADGGDAEGTAGVDAGAG 100 >04_04_0578 + 26353830-26353929,26354030-26354277,26354539-26354931 Length = 246 Score = 31.1 bits (67), Expect = 0.93 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = +1 Query: 277 LNGGEYRGFWVRWDSGIISAGREGEAIPFISWSDPEP 387 L G +R WV W +I AG G F+ PEP Sbjct: 195 LVGWNWRHHWVYWLGPLIGAGMAGALYEFVMAEQPEP 231 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 30.7 bits (66), Expect = 1.2 Identities = 15/29 (51%), Positives = 18/29 (62%), Gaps = 2/29 (6%) Frame = +3 Query: 504 P*GYGGNVPPPSGGYGG--NVPPPSGGAG 584 P G GG PP GG GG ++PP +GG G Sbjct: 100 PLGGGGARPPGGGGGGGPPSLPPGAGGGG 128 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 2/27 (7%) Frame = +3 Query: 510 GYGG--NVPPPSGGYGGNVPPPSGGAG 584 G GG ++PP +GG GG PP GG G Sbjct: 113 GGGGPPSLPPGAGGGGGARPPAPGGGG 139 Score = 29.1 bits (62), Expect = 3.8 Identities = 16/28 (57%), Positives = 16/28 (57%) Frame = +3 Query: 501 LP*GYGGNVPPPSGGYGGNVPPPSGGAG 584 LP G GG P P GG GG PP GG G Sbjct: 90 LPPG-GGGAPGPLGG-GGARPPGGGGGG 115 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGAG 584 G G PP GG GG + P GG G Sbjct: 153 GGGALARPPGGGRGGALGRPPGGGG 177 >06_01_0493 - 3536207-3537056,3537603-3537826,3538234-3538503, 3539042-3539146 Length = 482 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/41 (39%), Positives = 19/41 (46%) Frame = +3 Query: 447 RSATDCTCSSCIVRSTPWLP*GYGGNVPPPSGGYGGNVPPP 569 + A SS +S P P Y G PP YGG +PPP Sbjct: 392 QQAAQAQASSSSGQSYPMPPQYYHGQYPPYYPPYGGYMPPP 432 >09_04_0377 + 17086775-17088310 Length = 511 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +2 Query: 515 RRKRTPSVWRLRRKRTPSVWRSR 583 RR R+PS +R RR R+PS +R R Sbjct: 43 RRDRSPSPYRSRRDRSPSPYRDR 65 >06_01_0172 + 1362101-1363708 Length = 535 Score = 30.3 bits (65), Expect = 1.6 Identities = 23/67 (34%), Positives = 32/67 (47%), Gaps = 2/67 (2%) Frame = +2 Query: 257 KLKAPEFLTEGNIVVFGFVGIAELSPLDARVKLFHSY--LGLIPNLSQFTTSESAQAGVP 430 KL L NI++ G VGI +L DA +K+ LG+ P++ +TT SA G Sbjct: 186 KLYITPNLVSCNILLKGLVGIGDL---DAALKVLDEMPGLGITPDVVTYTTVLSAYCGKG 242 Query: 431 QAPGKSK 451 G K Sbjct: 243 DIEGAQK 249 >07_03_1267 + 25318220-25318407,25318674-25318844,25319086-25319188, 25319394-25319885,25320723-25321156,25321333-25321388, 25321711-25321775,25322139-25322147 Length = 505 Score = 29.9 bits (64), Expect = 2.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +3 Query: 534 PSGGYGGNVPPPSGGA 581 P GG GG +PPP GGA Sbjct: 77 PDGGGGGEMPPPYGGA 92 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPP 569 G GG +PPP GG PPP Sbjct: 80 GGGGEMPPPYGGAAAAPPPP 99 >04_01_0162 + 1845295-1846317,1846430-1846565,1848436-1848626, 1848780-1848887,1849001-1849204,1849294-1849525, 1849602-1849751,1849830-1850007,1850416-1850519, 1850611-1850933,1851274-1851459,1851672-1851899 Length = 1020 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 519 GNVPPPSGGYGGNVPPPSGG 578 G PPPS G G PPPS G Sbjct: 125 GTAPPPSQGPFGTAPPPSQG 144 Score = 29.9 bits (64), Expect = 2.2 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 519 GNVPPPSGGYGGNVPPPSGG 578 G PPPS G G PPPS G Sbjct: 136 GTAPPPSQGPFGTAPPPSQG 155 >11_06_0283 + 21905706-21905835,21906059-21906132 Length = 67 Score = 29.5 bits (63), Expect = 2.8 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +3 Query: 519 GNVPPPSGGYGGNVPPPSGGAGIWV 593 G V PPS GG P SG G+W+ Sbjct: 23 GEVDPPSLSLGGAHPLSSGSGGMWI 47 >01_06_0837 - 32328191-32328369,32328682-32328731,32328844-32328923, 32329193-32329345,32329505-32329654,32329877-32330000, 32330086-32330198,32330287-32330420,32330566-32331232 Length = 549 Score = 29.5 bits (63), Expect = 2.8 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 3/49 (6%) Frame = +1 Query: 265 SPGILNGGEYRGF---WVRWDSGIISAGREGEAIPFISWSDPEPFPVYY 402 SP +L GG Y G W+R I+ G + P + + D P ++Y Sbjct: 211 SPVVLFGGSYGGMLAAWMRLKYPHIAVGALASSAPILQFEDVVPSTIFY 259 >01_05_0173 + 18916930-18917324,18917542-18917638 Length = 163 Score = 29.5 bits (63), Expect = 2.8 Identities = 19/46 (41%), Positives = 20/46 (43%) Frame = +3 Query: 411 LHRLGCHRLLENRSATDCTCSSCIVRSTPWLP*GYGGNVPPPSGGY 548 LHRL HRLL S S S P P G N PPP G+ Sbjct: 53 LHRLISHRLLSPTSLAHAASSPPPTLSVPPPPSGRTINHPPPLFGF 98 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 29.5 bits (63), Expect = 2.8 Identities = 14/25 (56%), Positives = 14/25 (56%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGAG 584 GYGG P P GG G PP GG G Sbjct: 381 GYGGR-PMPGGGGPGAPPPYHGGGG 404 Score = 28.7 bits (61), Expect = 5.0 Identities = 13/27 (48%), Positives = 13/27 (48%) Frame = +3 Query: 504 P*GYGGNVPPPSGGYGGNVPPPSGGAG 584 P G G P GGYGG P GG G Sbjct: 368 PGGQGSLPPSYDGGYGGRPMPGGGGPG 394 >06_01_0738 + 5458182-5458374,5460512-5461766,5461861-5462053, 5462151-5462344,5462443-5462601,5462683-5463025 Length = 778 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGAG 584 G GG+ PPP G PP G G Sbjct: 84 GGGGSAPPPGNLAGSGTPPAKGSGG 108 >04_04_0260 + 23996775-23996865,23997031-23997566,23998407-23998892, 23998989-23999152,23999220-23999281,23999753-23999907, 24000625-24000738,24001701-24002233,24002512-24002609, 24003108-24003398,24003764-24003830,24003905-24003983 Length = 891 Score = 29.1 bits (62), Expect = 3.8 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -3 Query: 359 GIASPSRPAEIIPLSQRTQKPRYSPPLRIPGLSISP 252 G+ S R P ++R ++ +PP PGLS+SP Sbjct: 560 GMESHRRAPPFFPNAERRRRQPKTPPSSPPGLSVSP 595 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 28.7 bits (61), Expect = 5.0 Identities = 12/23 (52%), Positives = 12/23 (52%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGG 578 GY G PPP Y GN P GG Sbjct: 318 GYQGPPPPPPSAYQGNNPGYQGG 340 >12_02_0998 + 25126114-25126596,25129213-25129339,25129349-25129459, 25130122-25130270,25130356-25130643,25130753-25130941, 25131445-25131619,25132219-25132316 Length = 539 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +3 Query: 504 P*GYGGNVPPPSGGYGGN 557 P G+ NVPP GYGGN Sbjct: 313 PWGHPSNVPPGGPGYGGN 330 >07_03_1767 + 29338867-29338912,29339261-29339325,29339571-29339642, 29339913-29339956,29340047-29340158,29340879-29340950, 29341449-29341511,29341957-29342034,29342110-29342202, 29342294-29342413,29342762-29342845,29343094-29343309, 29343401-29343448,29343761-29343871,29344170-29344267, 29345004-29345248,29345764-29345832,29345919-29345983, 29346168-29346337,29346434-29346512,29346614-29346869, 29347416-29347461,29347602-29347710,29347820-29347882, 29350075-29350107,29350924-29351442 Length = 991 Score = 28.3 bits (60), Expect = 6.6 Identities = 22/71 (30%), Positives = 35/71 (49%) Frame = -2 Query: 426 TPACADSDVVNWERFGIRPRYEWNSFTLASSGDNSAIPTNPKTTIFPSVKNSGAFNFTLS 247 TP S+V++ R G+ + + D +PT P T++ PS +N+G F T Sbjct: 288 TPPRFPSEVIDCIRQGVSILFRCLGLRDFARIDGWFLPT-PVTSL-PSAENTGKFGNTKY 345 Query: 246 GLVLFFLMTLL 214 G VLF + L+ Sbjct: 346 GAVLFTDINLM 356 >03_06_0485 + 34242121-34243188 Length = 355 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/30 (46%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGA-GIWVD 596 G GGN +GG G V P GG+ G W D Sbjct: 313 GPGGNGDGATGGSGAGVAPGGGGSGGGWAD 342 >02_03_0101 + 15233783-15234601 Length = 272 Score = 28.3 bits (60), Expect = 6.6 Identities = 14/51 (27%), Positives = 25/51 (49%) Frame = +2 Query: 230 KNRTKPDKVKLKAPEFLTEGNIVVFGFVGIAELSPLDARVKLFHSYLGLIP 382 + R + V + PE T+G V+ + + P+ RV+LF Y+ + P Sbjct: 209 RRRRRSMMVHPEPPEHTTDGMPVILESMALVSTPPVAKRVRLFGVYIDVPP 259 >11_04_0355 + 16705281-16706006 Length = 241 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +2 Query: 185 EVMIGGWGNAKSVIRKNRTKPDKVKLKAPEFLTEG 289 E ++GG A S RK R+ DK K K P + G Sbjct: 131 EEVVGGGKGASSRRRKKRSGKDKAKAKVPPAASAG 165 >10_08_0551 + 18702081-18702251,18702328-18702424,18702533-18702651, 18702757-18702924,18703296-18703424,18703659-18703719, 18703813-18703916,18704173-18704279,18704319-18704493, 18704657-18704770,18704883-18704966,18705536-18705608, 18705689-18705775,18705863-18705917,18706007-18706078, 18706470-18706532,18706640-18706754,18706844-18706915 Length = 621 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +1 Query: 238 NQAR*GEIESPGILNGGE-YRGFWVRWDSGIISAGREG 348 N A+ + PGI GE + FWV G+I+ R+G Sbjct: 349 NMAKQAMLRMPGINRSGEGHNQFWVLDKDGLITKSRKG 386 >07_03_0039 - 12718972-12720699 Length = 575 Score = 27.9 bits (59), Expect = 8.7 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 2/53 (3%) Frame = -2 Query: 297 TIFPSVKNSGAFNFTLSGLVLFFLMTLLAFPQPPIITSYIGS-DSC-GPVVSA 145 ++ P+V F F S L L F LL P P +ITS + S ++C GP+ A Sbjct: 130 SLLPAVAALAHFGFPWSRLGLLFPTVLLRLP-PDLITSRLASLEACLGPLPRA 181 >06_02_0127 + 12140843-12140966,12141170-12141567 Length = 173 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGAG 584 GYGG GGYGG GG G Sbjct: 88 GYGGGYGGYGGGYGGGYGGGGGGGG 112 >06_02_0126 + 12130409-12130532,12131015-12131373 Length = 160 Score = 27.9 bits (59), Expect = 8.7 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +3 Query: 510 GYGGNVPPPSGGYGGNVPPPSGGAG 584 GYGG GGYGG GG G Sbjct: 88 GYGGGYGGYGGGYGGGYGGGGGGGG 112 >05_04_0114 + 18090593-18092248 Length = 551 Score = 27.9 bits (59), Expect = 8.7 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 1/48 (2%) Frame = +3 Query: 450 SATDCTCSSCIVRSTPWLP*GYGGNVPPPSGGYGGNVP-PPSGGAGIW 590 S + T +V + P P G P GYGG+ P S A +W Sbjct: 501 SVSTWTARRVLVPAPPLWPPAAAGGAGPSGSGYGGDGPSTASSSAAMW 548 >05_03_0604 - 16132173-16132391,16132488-16132556,16132824-16132898, 16132981-16133113,16133188-16133297,16133360-16133407, 16133657-16133983,16135006-16135233,16135360-16135689, 16135780-16136586 Length = 781 Score = 27.9 bits (59), Expect = 8.7 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 3/59 (5%) Frame = +1 Query: 256 EIESPGILNGGEYRGFWVRWDSGIIS--AGREGEAIPFISWSDPEP-FPVYYVGVCTGW 423 ++ G+ ++ +W+ G+IS GR W DP+P V YVG+ + W Sbjct: 89 DVAGIGLCCSSSFQSYWISIYDGLISIGQGRHPNNNILFQWLDPDPNRNVQYVGL-SSW 146 >01_05_0791 + 25267885-25267930,25268258-25268713,25268802-25268832, 25268949-25269255 Length = 279 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 504 P*GYGGNVPPPSGGYGGNVPPPSGGAG 584 P YG PP GG+G N PP G G Sbjct: 225 PPDYGSMSPP--GGFGSNSPPDYGDVG 249 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,285,821 Number of Sequences: 37544 Number of extensions: 549145 Number of successful extensions: 2408 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 1947 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2338 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1898162308 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -