BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0168X.Seq (441 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1015 - 30115377-30115477,30115570-30115615,30116491-301165... 31 0.31 04_04_1008 - 30054674-30054774,30054867-30054912,30055788-300558... 31 0.31 09_06_0365 - 22582467-22583524,22584407-22584641,22585474-225856... 31 0.54 08_02_1614 - 28243532-28244589,28245149-28245383,28245524-282457... 31 0.54 04_04_1439 + 33614112-33614123,33614278-33615649,33615705-33616141 29 1.7 03_04_0206 - 18493178-18495310 28 3.8 09_02_0565 + 10710770-10711003,10711368-10711527,10712277-107124... 27 5.1 02_05_1104 + 34146610-34146614,34147108-34147231,34147480-341475... 27 5.1 02_05_1101 + 34122061-34122065,34122559-34122682,34122931-341229... 27 5.1 12_02_0691 - 22195142-22196197 27 8.8 12_02_0457 + 19239816-19241319,19241337-19241632,19241729-192418... 27 8.8 04_01_0567 - 7263744-7263922,7264020-7264259,7264919-7264982,726... 27 8.8 03_06_0408 - 33722741-33722893,33723174-33723350,33723798-337239... 27 8.8 03_05_0990 - 29503950-29504462,29504567-29504686,29514956-295150... 27 8.8 01_01_0545 - 4002659-4003307,4003415-4003887 27 8.8 >04_04_1015 - 30115377-30115477,30115570-30115615,30116491-30116590, 30116676-30116771,30119519-30119556,30119623-30119733, 30119820-30119951,30120024-30120263,30120532-30120700, 30120994-30121493,30121581-30121691,30121802-30122133, 30122603-30122737,30122839-30122988,30123809-30123947 Length = 799 Score = 31.5 bits (68), Expect = 0.31 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 311 EIRXAVVGNVDAGKSTLLGVLTH 379 ++ A+VG+VD+GKSTL G L H Sbjct: 247 QLNLAIVGHVDSGKSTLSGRLLH 269 >04_04_1008 - 30054674-30054774,30054867-30054912,30055788-30055887, 30055973-30056068,30058816-30058853,30058920-30059030, 30059117-30059248,30059321-30059560,30059829-30059997, 30060291-30060790,30060878-30060988,30061099-30061430, 30061900-30062034,30062136-30062285,30063106-30063244 Length = 799 Score = 31.5 bits (68), Expect = 0.31 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 311 EIRXAVVGNVDAGKSTLLGVLTH 379 ++ A+VG+VD+GKSTL G L H Sbjct: 247 QLNLAIVGHVDSGKSTLSGRLLH 269 >09_06_0365 - 22582467-22583524,22584407-22584641,22585474-22585684, 22585775-22585848,22585943-22586092 Length = 575 Score = 30.7 bits (66), Expect = 0.54 Identities = 26/65 (40%), Positives = 32/65 (49%) Frame = +2 Query: 242 VGVWSGLTGQYLLRTELDNNDFXEIRXAVVGNVDAGKSTLLGVLTHGELDNGRGYARHML 421 V V G T L+ LD + R A+VG AGKSTLL ++T G+L G R Sbjct: 363 VEVTFGYTPDNLIYKNLDFGVDLDSRVALVGPNGAGKSTLLKLMT-GDLIPLDGMVR--- 418 Query: 422 FRHKH 436 RH H Sbjct: 419 -RHNH 422 >08_02_1614 - 28243532-28244589,28245149-28245383,28245524-28245734, 28245834-28245907,28246465-28246665 Length = 592 Score = 30.7 bits (66), Expect = 0.54 Identities = 26/65 (40%), Positives = 32/65 (49%) Frame = +2 Query: 242 VGVWSGLTGQYLLRTELDNNDFXEIRXAVVGNVDAGKSTLLGVLTHGELDNGRGYARHML 421 V V G T L+ LD + R A+VG AGKSTLL ++T G+L G R Sbjct: 380 VEVSFGYTPDNLIYKNLDFGVDLDSRIALVGPNGAGKSTLLKLMT-GDLAPLDGMVR--- 435 Query: 422 FRHKH 436 RH H Sbjct: 436 -RHNH 439 >04_04_1439 + 33614112-33614123,33614278-33615649,33615705-33616141 Length = 606 Score = 29.1 bits (62), Expect = 1.7 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = +2 Query: 317 RXAVVGNVDAGKSTLLGVLTHGELDNGRGYAR 412 R AVVG AGKSTLL +L GEL G AR Sbjct: 403 RVAVVGPNGAGKSTLLKLLA-GELTPTSGEAR 433 >03_04_0206 - 18493178-18495310 Length = 710 Score = 27.9 bits (59), Expect = 3.8 Identities = 16/32 (50%), Positives = 20/32 (62%) Frame = +2 Query: 317 RXAVVGNVDAGKSTLLGVLTHGELDNGRGYAR 412 R A+VG AGKSTLL +L G+L +G R Sbjct: 512 RVAIVGPNGAGKSTLLNLLA-GDLTPTKGEVR 542 >09_02_0565 + 10710770-10711003,10711368-10711527,10712277-10712477, 10712564-10712628,10712740-10712767,10712847-10712923, 10713023-10713109,10713572-10713622,10713857-10713937, 10714125-10714346,10714424-10714517,10714608-10714748, 10716383-10716444,10716519-10717106 Length = 696 Score = 27.5 bits (58), Expect = 5.1 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 34 W*W*VQMLMSMSYSVNSYWKGLKLEMARSFMILDMEKMVGV 156 W W + +L M + WK LK+ ++SF + ++ V V Sbjct: 293 WYWILNLLQLMFLFIPKKWKPLKITYSKSFTLYGIKIPVSV 333 >02_05_1104 + 34146610-34146614,34147108-34147231,34147480-34147514, 34149924-34150269 Length = 169 Score = 27.5 bits (58), Expect = 5.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 159 TEDEYNASLATLHSLVASERVSCVELRRWECGVGS 263 T Y A++ S ++CVE +RW CG G+ Sbjct: 23 TIGSYTATITECTSGPPLFSLACVEKKRWNCGSGA 57 >02_05_1101 + 34122061-34122065,34122559-34122682,34122931-34122965, 34125375-34125720 Length = 169 Score = 27.5 bits (58), Expect = 5.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 159 TEDEYNASLATLHSLVASERVSCVELRRWECGVGS 263 T Y A++ S ++CVE +RW CG G+ Sbjct: 23 TIGSYTATITECTSGPPLFSLACVEKKRWNCGSGA 57 >12_02_0691 - 22195142-22196197 Length = 351 Score = 26.6 bits (56), Expect = 8.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +2 Query: 338 VDAGKSTLLGVLTHGELDNGRGYARHMLFR 427 +DAG + LLG + GE+ R +H ++R Sbjct: 282 MDAGAAVLLGRVIAGEITMARETGKHSIYR 311 >12_02_0457 + 19239816-19241319,19241337-19241632,19241729-19241829, 19241939-19242029,19242158-19242268,19242360-19242425, 19242457-19242462 Length = 724 Score = 26.6 bits (56), Expect = 8.8 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +2 Query: 326 VVGNVDAGKSTLLGVLTHGELDNG 397 ++G+VDAGK+ LL + H + G Sbjct: 451 ILGHVDAGKTKLLDCIRHTNVQKG 474 >04_01_0567 - 7263744-7263922,7264020-7264259,7264919-7264982, 7265088-7265393,7265652-7265866,7266195-7266489, 7266596-7266655,7267091-7267717,7268510-7268596, 7269292-7269612,7270051-7270224,7272806-7275022 Length = 1594 Score = 26.6 bits (56), Expect = 8.8 Identities = 14/27 (51%), Positives = 18/27 (66%) Frame = +2 Query: 323 AVVGNVDAGKSTLLGVLTHGELDNGRG 403 AVVG V +GKS+LL + GE+D G Sbjct: 713 AVVGTVGSGKSSLLSCIM-GEMDKVSG 738 >03_06_0408 - 33722741-33722893,33723174-33723350,33723798-33723947, 33724085-33724145,33724338-33724558 Length = 253 Score = 26.6 bits (56), Expect = 8.8 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 311 EIRXAVVGNVDAGKSTLLGVLTHGEL-DNGRGYAR 412 ++R AV+G+ GKS+L+ + G D G AR Sbjct: 14 DVRVAVIGDHGTGKSSLVATIATGRFPDQDDGVAR 48 >03_05_0990 - 29503950-29504462,29504567-29504686,29514956-29515012, 29515635-29515689,29515765-29515845,29515928-29515983, 29516112-29516256,29516347-29516415,29517355-29517467, 29517619-29517708,29518112-29518176,29519256-29519667 Length = 591 Score = 26.6 bits (56), Expect = 8.8 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +2 Query: 314 IRXAVVGNVDAGKSTLLGVLTHGEL 388 + AVVG +AGKSTL+ L+ +L Sbjct: 288 VTVAVVGYTNAGKSTLVSALSETDL 312 >01_01_0545 - 4002659-4003307,4003415-4003887 Length = 373 Score = 26.6 bits (56), Expect = 8.8 Identities = 18/50 (36%), Positives = 25/50 (50%) Frame = +3 Query: 129 IGHGEDGRGLTEDEYNASLATLHSLVASERVSCVELRRWECGVGSPANTS 278 +GHG L+ E +A + SL ASE++ V CG GSP +S Sbjct: 74 VGHGVPAALLSRVEER--VARVFSLPASEKMRAVRGPGEPCGYGSPPISS 121 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,154,989 Number of Sequences: 37544 Number of extensions: 280532 Number of successful extensions: 922 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 892 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 920 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 835800280 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -