BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0167.Seq (787 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 3.2 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 4.3 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.8 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 23.0 bits (47), Expect = 3.2 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +3 Query: 180 SWTNFLEDKENPSLEDPDVVLS 245 SW N +++ N + DP ++L+ Sbjct: 270 SWRNLMDEHSNRTNSDPRMILT 291 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 22.6 bits (46), Expect = 4.3 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = +1 Query: 373 DTSARLVCELCRLG 414 DT+ R+VC+ C +G Sbjct: 349 DTTYRVVCDACSMG 362 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 9.8 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 66 SSRSLVNNFEDARNYIETQKDKVIEEWSSYMEDIKLSSSWTNFLEDKEN 212 S+R N E+A T+ K +W Y E K L++KEN Sbjct: 473 STRPKSNTVENACVLKNTEIFKDKSDWFDYSEVSKWVQKGQICLKEKEN 521 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,392 Number of Sequences: 438 Number of extensions: 4396 Number of successful extensions: 11 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24760908 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -