Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pg--0166.Seq
         (441 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_49327| Best HMM Match : PKD_channel (HMM E-Value=0)                 28   3.9  
SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   5.2  
SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.9  
SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.9  
SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)              27   6.9  
SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.9  
SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)                   27   6.9  
SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)                  27   6.9  
SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)                27   6.9  
SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.9  
SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.9  
SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)           27   6.9  
SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.9  
SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)              27   6.9  
SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)                       27   6.9  
SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)               27   6.9  
SB_4159| Best HMM Match : Vpu (HMM E-Value=2)                          27   6.9  

>SB_49327| Best HMM Match : PKD_channel (HMM E-Value=0)
          Length = 1196

 Score = 27.9 bits (59), Expect = 3.9
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 2/42 (4%)
 Frame = -3

Query: 436  TTHYRANWVPGPTLFMFHSFLLTLRLSNTFFASV--AFSKIK 317
            T   R N + GP LF F   ++ + L N F A +  AF+K++
Sbjct: 893  TATERQNKIIGPLLFFFFMVVMVMILMNIFLAILMDAFAKVQ 934


>SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 141

 Score = 27.5 bits (58), Expect = 5.2
 Identities = 16/38 (42%), Positives = 18/38 (47%), Gaps = 3/38 (7%)
 Frame = +1

Query: 337 HWRKMCSIDAVXXXXXXXXXXLGPVP---NSPYSESYY 441
           H+RK+ SI               P P   NSPYSESYY
Sbjct: 10  HYRKIVSISNSCSPGEPLVLERPPPPWSSNSPYSESYY 47


>SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 408

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 16  NTTHYRANW 24


>SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 287

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 72  NTTHYRANW 80


>SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045)
          Length = 2506

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 640 NTTHYRANW 648


>SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 63

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 51  NTTHYRANW 59


>SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37)
          Length = 257

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 13  NTTHYRANW 21


>SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4)
          Length = 117

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 53  NTTHYRANW 61


>SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 1907

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439  NTTHYRANW 413
            NTTHYRANW
Sbjct: 1891 NTTHYRANW 1899


>SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 206

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 51  NTTHYRANW 59


>SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 204

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 13  NTTHYRANW 21


>SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40)
          Length = 768

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 45  NTTHYRANW 53


>SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 602

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 94  NTTHYRANW 102


>SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 119

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 72  NTTHYRANW 80


>SB_10526| Best HMM Match : CUE (HMM E-Value=6.5)
          Length = 281

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 83  NTTHYRANW 91


>SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 197

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 59  NTTHYRANW 67


>SB_4159| Best HMM Match : Vpu (HMM E-Value=2)
          Length = 779

 Score = 27.1 bits (57), Expect = 6.9
 Identities = 9/9 (100%), Positives = 9/9 (100%)
 Frame = -3

Query: 439 NTTHYRANW 413
           NTTHYRANW
Sbjct: 83  NTTHYRANW 91


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,438,687
Number of Sequences: 59808
Number of extensions: 261274
Number of successful extensions: 2020
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 1979
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2020
length of database: 16,821,457
effective HSP length: 76
effective length of database: 12,276,049
effective search space used: 859323430
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)