BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0166.Seq (441 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61740.1 68418.m07747 ABC transporter family protein ABC fami... 27 7.4 At1g04650.1 68414.m00462 hypothetical protein 27 7.4 >At5g61740.1 68418.m07747 ABC transporter family protein ABC family transporter, Entamoeba histolytica, TREMBL:EH058 Length = 848 Score = 26.6 bits (56), Expect = 7.4 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -3 Query: 394 FMFHSFLLTLRLSNTFFASVAFSKIK 317 F+F+ + L++S F AS FSK+K Sbjct: 345 FIFYFIFVNLQISFAFLASSIFSKVK 370 >At1g04650.1 68414.m00462 hypothetical protein Length = 936 Score = 26.6 bits (56), Expect = 7.4 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -3 Query: 175 NIIVNYHFFQQLTSKQEVSLREYKRRRIVKWELHSVIICGPRAWAMSRKVTTWF 14 N N+H SK E+S + + I WEL+ +++ R WA+ T F Sbjct: 724 NSETNHHHNHLRLSKYEMSETKKCPKSIAVWELYHMLL-RKRHWALVHHAVTAF 776 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,279,517 Number of Sequences: 28952 Number of extensions: 170960 Number of successful extensions: 366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 366 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 702840360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -