BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0165.Seq (764 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 22 6.2 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.2 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -1 Query: 122 PGWSSRKAATSYTTLSMMI 66 PG S++AA +Y+TL+ + Sbjct: 257 PGGDSQQAALNYSTLASAV 275 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 8.2 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = -1 Query: 164 EASEPALSTRTSVPPGWSSRKAATSYTTLSMMIRFCLLLS 45 E +PAL +VP G + KA +S + F L++ Sbjct: 239 EIKKPALLLSAAVPVGPDNIKAGYDVPAVSSYLDFINLMA 278 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,416 Number of Sequences: 336 Number of extensions: 2934 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -