BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0165.Seq (764 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 prot... 86 1e-18 AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. 24 5.9 >AY183376-1|AAO24766.1| 128|Anopheles gambiae cytochrome b5 protein. Length = 128 Score = 86.2 bits (204), Expect = 1e-18 Identities = 38/81 (46%), Positives = 54/81 (66%) Frame = +1 Query: 10 VHKYTRAEVAARDNNKQNLIIIDNVVYDVAAFLEDHPGGTEVLVDNAGSDASECFHEVGH 189 V Y+ A+V + + NK I+I N +YDV FL +HPGG EVL++ AG +A+E F +VGH Sbjct: 4 VKTYSLADVKSHNTNKSTWIVIHNDIYDVTEFLNEHPGGEEVLLEQAGREATEAFEDVGH 63 Query: 190 SEIAIEWRNTFKVGEIVDEEK 252 S A E FKVGE+++ E+ Sbjct: 64 SSDAREMMKKFKVGELIEAER 84 >AY973196-1|AAY41590.1| 94|Anopheles gambiae defensin 4 protein. Length = 94 Score = 23.8 bits (49), Expect = 5.9 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = -3 Query: 411 SAHCTGRASRTGTCRAG 361 SA C GR R G+C G Sbjct: 71 SAQCRGRGYRRGSCTIG 87 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 675,615 Number of Sequences: 2352 Number of extensions: 12052 Number of successful extensions: 65 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 65 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 65 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79418373 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -