Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pg--0161.Seq
         (757 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_34661| Best HMM Match : Fz (HMM E-Value=0.00016)                    31   1.3  
SB_55577| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   9.4  

>SB_34661| Best HMM Match : Fz (HMM E-Value=0.00016)
          Length = 486

 Score = 30.7 bits (66), Expect = 1.3
 Identities = 16/44 (36%), Positives = 21/44 (47%)
 Frame = +2

Query: 146 PPCIGFRSTLPLLYITFVPCSFSHISRPVQPCCCGCSHLET*IC 277
           P C G   T  L Y  F PC+ + I RP+  C   C  L+  +C
Sbjct: 165 PKC-GKHLTKALCYHLFPPCTKNAIQRPIYICKAQCEILKGSVC 207


>SB_55577| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 272

 Score = 27.9 bits (59), Expect = 9.4
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +2

Query: 215 HISRPVQPCCCGC 253
           H+  PV PCCC C
Sbjct: 77  HVELPVSPCCCLC 89


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 23,113,542
Number of Sequences: 59808
Number of extensions: 483801
Number of successful extensions: 1202
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 1092
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1200
length of database: 16,821,457
effective HSP length: 80
effective length of database: 12,036,817
effective search space used: 2058295707
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)