BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0161.Seq (757 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X86693-1|CAA60386.1| 664|Homo sapiens Hevin-like protein protein. 33 1.1 X82157-1|CAA57650.1| 664|Homo sapiens hevin protein. 33 1.1 BC033721-1|AAH33721.1| 664|Homo sapiens SPARC-like 1 (mast9, he... 33 1.1 AY513278-1|AAT08031.1| 664|Homo sapiens proliferation-inducing ... 33 1.1 >X86693-1|CAA60386.1| 664|Homo sapiens Hevin-like protein protein. Length = 664 Score = 33.1 bits (72), Expect = 1.1 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -2 Query: 288 SKNIQIHVSRCEQPQQQGCTGLEICENEQGTNVIYKSGRVLRNPMQGGPATGDDH 124 + N+ H+ E Q+G TGLE N + T S +L P G T +H Sbjct: 281 ASNVNKHIQETEWQSQEGKTGLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNH 335 >X82157-1|CAA57650.1| 664|Homo sapiens hevin protein. Length = 664 Score = 33.1 bits (72), Expect = 1.1 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -2 Query: 288 SKNIQIHVSRCEQPQQQGCTGLEICENEQGTNVIYKSGRVLRNPMQGGPATGDDH 124 + N+ H+ E Q+G TGLE N + T S +L P G T +H Sbjct: 281 ASNVNKHIQETEWQSQEGKTGLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNH 335 >BC033721-1|AAH33721.1| 664|Homo sapiens SPARC-like 1 (mast9, hevin) protein. Length = 664 Score = 33.1 bits (72), Expect = 1.1 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -2 Query: 288 SKNIQIHVSRCEQPQQQGCTGLEICENEQGTNVIYKSGRVLRNPMQGGPATGDDH 124 + N+ H+ E Q+G TGLE N + T S +L P G T +H Sbjct: 281 ASNVNKHIQETEWQSQEGKTGLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNH 335 >AY513278-1|AAT08031.1| 664|Homo sapiens proliferation-inducing protein 33 protein. Length = 664 Score = 33.1 bits (72), Expect = 1.1 Identities = 17/55 (30%), Positives = 24/55 (43%) Frame = -2 Query: 288 SKNIQIHVSRCEQPQQQGCTGLEICENEQGTNVIYKSGRVLRNPMQGGPATGDDH 124 + N+ H+ E Q+G TGLE N + T S +L P G T +H Sbjct: 281 ASNVNKHIQETEWQSQEGKTGLEAISNHKETEEKTVSEALLMEPTDDGNTTPRNH 335 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 106,888,514 Number of Sequences: 237096 Number of extensions: 2364878 Number of successful extensions: 4871 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4870 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9127122082 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -