BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0161.Seq (757 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65910.1 68418.m08296 BSD domain-containing protein contains ... 30 1.4 At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family... 29 4.4 At1g11840.2 68414.m01362 lactoylglutathione lyase, putative / gl... 29 4.4 At1g11840.1 68414.m01361 lactoylglutathione lyase, putative / gl... 29 4.4 At1g54490.1 68414.m06215 5'-3' exoribonuclease (XRN4) identical ... 28 5.8 >At5g65910.1 68418.m08296 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 432 Score = 30.3 bits (65), Expect = 1.4 Identities = 20/53 (37%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = -2 Query: 162 NPMQGGPATGDDHPCARLQTQIMS---IEARSTGDGSGVCSGRLFCVQVDGDD 13 NP++ D HP + QI+ IE RST S S R VQVD +D Sbjct: 289 NPVESSDVETDKHPIESKEIQIVDKSVIEERSTSTAS---SSRFINVQVDDED 338 >At1g21580.1 68414.m02698 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 1696 Score = 28.7 bits (61), Expect = 4.4 Identities = 13/51 (25%), Positives = 23/51 (45%) Frame = -2 Query: 207 EQGTNVIYKSGRVLRNPMQGGPATGDDHPCARLQTQIMSIEARSTGDGSGV 55 + + + K +LR P G P P + +Q ++E +STG + V Sbjct: 1455 QSNNSYVRKGNSLLRKPSHGSPGAALGIPPSAIQLNHFTVEDKSTGSSNMV 1505 >At1g11840.2 68414.m01362 lactoylglutathione lyase, putative / glyoxalase I, putative highly similar to putative lactoylglutathione lyase SP:Q39366 from [Brassica oleracea] Length = 283 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -2 Query: 201 GTNVIYKSGRVLR--NPMQGGPATGDDHPCARLQTQIMS 91 GT+ +YKSG V++ N GG T + P L T+I+S Sbjct: 223 GTDDVYKSGEVIKIVNQELGGKITREAGPLPGLGTKIVS 261 >At1g11840.1 68414.m01361 lactoylglutathione lyase, putative / glyoxalase I, putative highly similar to putative lactoylglutathione lyase SP:Q39366 from [Brassica oleracea] Length = 283 Score = 28.7 bits (61), Expect = 4.4 Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 2/39 (5%) Frame = -2 Query: 201 GTNVIYKSGRVLR--NPMQGGPATGDDHPCARLQTQIMS 91 GT+ +YKSG V++ N GG T + P L T+I+S Sbjct: 223 GTDDVYKSGEVIKIVNQELGGKITREAGPLPGLGTKIVS 261 >At1g54490.1 68414.m06215 5'-3' exoribonuclease (XRN4) identical to XRN4 [Arabidopsis thaliana] GI:11875626; contains Pfam domain PF03159: Putative 5'-3' exonuclease domain Length = 947 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +2 Query: 131 SPVAGPPCIGFRSTLPLLYITFVPCSFSHISRP 229 SPV G PCI L + Y+ P SHIS P Sbjct: 671 SPVNGLPCIEQNRALNVTYL--CPAKHSHISEP 701 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,836,013 Number of Sequences: 28952 Number of extensions: 330519 Number of successful extensions: 784 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 784 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -