BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0160.Seq (590 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0610 + 18944084-18944244,18944471-18944564,18944809-189449... 84 9e-17 >09_04_0610 + 18944084-18944244,18944471-18944564,18944809-18944928, 18945012-18945060,18945985-18946084,18946196-18946257, 18946365-18946426,18947080-18947187 Length = 251 Score = 83.8 bits (198), Expect = 9e-17 Identities = 41/112 (36%), Positives = 60/112 (53%), Gaps = 2/112 (1%) Frame = +1 Query: 256 RENGKYLPRQSFAMRRHWFNNEETGYFKVQKRAA--ASQNPMTDPGMMTDMLKGNLTNVL 429 R N +Y+P ++F R+ ++ NEE G V K A A +DP M DM+K NL+ ++ Sbjct: 64 RINSQYIPAKAFKSRKVYYTNEENGLLHVPKEEAQKAQAAMFSDPNMAMDMMKKNLSMIV 123 Query: 430 PMIVIGGWINWMFSGFLTTKVPFPLTRDSSRCFSAALS*RIWDASWGSSASW 585 P + W+N+ FSGF+ K+PFPLT + D S+ SS SW Sbjct: 124 PQTLTFAWVNFFFSGFVAAKIPFPLTPRFRGMLQNGIDLSTVDVSYVSSRSW 175 Score = 45.6 bits (103), Expect = 3e-05 Identities = 25/68 (36%), Positives = 44/68 (64%), Gaps = 3/68 (4%) Frame = +2 Query: 86 ELLLDPNIRFWVFLPIVIITFLVGIVRHYVSLIL---SSQKKIELIQVQDSQVMIRARLL 256 EL+LD IR WV +P+ ++ L+G++R++V+ ++ S+ + V++ QV+IRAR L Sbjct: 4 ELVLDTAIRDWVLVPLSVVMVLIGVLRYFVAKLMRSPSASPSPDPKLVKEGQVVIRARNL 63 Query: 257 ERTGSIYL 280 R S Y+ Sbjct: 64 -RINSQYI 70 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,314,797 Number of Sequences: 37544 Number of extensions: 304685 Number of successful extensions: 715 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 697 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 713 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1400060088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -