BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0152.Seq (638 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||... 29 0.75 SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyce... 26 5.3 SPBPB10D8.02c |||arylsulfatase |Schizosaccharomyces pombe|chr 2|... 26 5.3 SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3... 25 7.0 >SPAC10F6.03c |||CTP synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 600 Score = 28.7 bits (61), Expect = 0.75 Identities = 17/48 (35%), Positives = 24/48 (50%) Frame = +1 Query: 361 SVGGGAWPFLVGGAICLVNSGNERDSSLLNRRRYLGVRGLVSRNSLTT 504 ++ G L G + ++N G E D L N RYL V L N++TT Sbjct: 44 NIDAGTMSPLEHGEVFVLNDGGEVDLDLGNYERYLNVT-LTHDNNITT 90 >SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1210 Score = 25.8 bits (54), Expect = 5.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 409 DKSLHQLRTAMHHHPPNQERAVNLSILPV 323 D +LH + +H + E A NLSILP+ Sbjct: 1061 DDNLHHGEIYLRNHILSDEMANNLSILPI 1089 >SPBPB10D8.02c |||arylsulfatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 554 Score = 25.8 bits (54), Expect = 5.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 375 TTTHRIKKELLICQSFRCPGLVRFPVLSQIKP 280 T R+ K + RCP ++R+P L IKP Sbjct: 375 TAPSRLSKGFITEGGIRCPAIIRYPPL--IKP 404 >SPCC1620.07c |||lunapark homolog|Schizosaccharomyces pombe|chr 3|||Manual Length = 334 Score = 25.4 bits (53), Expect = 7.0 Identities = 12/32 (37%), Positives = 16/32 (50%), Gaps = 2/32 (6%) Frame = +1 Query: 22 SSQENISESICQRCFHQSRTKVRGSKA--IRY 111 +S+ N IC CFH + G KA +RY Sbjct: 191 NSENNREALICSHCFHHNGLASYGEKASDVRY 222 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,613,182 Number of Sequences: 5004 Number of extensions: 52591 Number of successful extensions: 144 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 144 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 285732116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -