BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0152.Seq (638 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g22790.1 68415.m02703 expressed protein ; expression supporte... 31 0.65 At1g67020.1 68414.m07620 hypothetical protein 29 2.6 At3g42120.1 68416.m04325 hypothetical protein 29 3.4 At2g35170.1 68415.m04314 MORN (Membrane Occupation and Recogniti... 29 3.4 At1g48660.1 68414.m05446 auxin-responsive GH3 family protein sim... 29 3.4 At1g19150.1 68414.m02384 chlorophyll A-B binding protein, putati... 29 3.4 At5g56120.1 68418.m07001 expressed protein similar to unknown pr... 28 6.0 At3g17465.1 68416.m02230 ribosomal protein L3 family protein 27 7.9 At1g13160.1 68414.m01526 SDA1 family protein contains Pfam PF052... 27 7.9 >At2g22790.1 68415.m02703 expressed protein ; expression supported by MPSS Length = 325 Score = 31.1 bits (67), Expect = 0.65 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 294 SQIKPQAPLLVVPSVNSFKFQLCNHTPPGVQN 199 S + P +P+ VN FK Q NH PG+ N Sbjct: 23 SSVNPSSPVYYKTIVNHFKSQTGNHVSPGLTN 54 >At1g67020.1 68414.m07620 hypothetical protein Length = 659 Score = 29.1 bits (62), Expect = 2.6 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = +1 Query: 160 TTMARRAASGKPKILDSGGSMVAKLKLKGIDGGHHQEW 273 ++M +R A P +LD+ S++ ++++ DG EW Sbjct: 86 SSMPQRGAGESPILLDNRSSLIRRIEMPVFDGSGVYEW 123 >At3g42120.1 68416.m04325 hypothetical protein Length = 409 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/68 (30%), Positives = 28/68 (41%), Gaps = 4/68 (5%) Frame = -3 Query: 378 CTTTH--RIKKELLICQSFRCPGLVRFPVLSQIKPQAPLLVVPSVNSFKFQLCNHTPPGV 205 C H +++ E LI FR PV + P APLL+ P ++ PP Sbjct: 261 CVDRHPTQVEPEFLIRAGFRVEFTTDTPVTTVTSPTAPLLLDPPPKRLRYSSPPPKPPDF 320 Query: 204 QN--LWFP 187 N L FP Sbjct: 321 INKSLKFP 328 >At2g35170.1 68415.m04314 MORN (Membrane Occupation and Recognition Nexus) repeat-containing protein /phosphatidylinositol-4-phosphate 5-kinase-related low similarity to phosphatidylinositol-4-phosphate 5-kinase AtPIP5K1 [Arabidopsis thaliana] GI:3702691; contains Pfam profile PF02493: MORN repeat Length = 484 Score = 28.7 bits (61), Expect = 3.4 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 4/64 (6%) Frame = +2 Query: 101 RLDTALVLT---VNMSSSDPPT-LLQWLGGQLPGNQRFWTPGGVWLQS*NLKELTEGTTR 268 RL A +LT SSS P T + W G P + T G W+Q ++ EG Sbjct: 177 RLFVARLLTFIPARFSSSQPSTDRVVWSIGSKPVAENNKTNSGSWVQKYGTNDMYEGEFH 236 Query: 269 SGAC 280 G C Sbjct: 237 RGKC 240 >At1g48660.1 68414.m05446 auxin-responsive GH3 family protein similar to auxin-responsive GH3 product [Glycine max] GI:18591; contains Pfam profile PF03321: GH3 auxin-responsive promoter Length = 573 Score = 28.7 bits (61), Expect = 3.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +1 Query: 154 DVTTMARRAASGKPKILDSGGSMVAKLKLKGIDGGHHQ 267 DV R A+G+P + SGG++ ++ G GG H+ Sbjct: 62 DVKPYIERVANGEPSDVISGGTITRFVQSTGTSGGIHK 99 >At1g19150.1 68414.m02384 chlorophyll A-B binding protein, putative / LHCI type II, putative very strong similarity to PSI type II chlorophyll a/b-binding protein Lhca2*1 GI:541565 from [Arabidopsis thaliana]; contains Pfam profile: PF00504 chlorophyll A-B binding protein Length = 270 Score = 28.7 bits (61), Expect = 3.4 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -3 Query: 267 LVVPSVNSFKFQLCNHTPPGVQNLWFPGSCPP 172 LVV +C PP + LWFPGS PP Sbjct: 45 LVVVRAGKEVSSVCEPLPPD-RPLWFPGSSPP 75 >At5g56120.1 68418.m07001 expressed protein similar to unknown protein (dbj|BAA81760.1) Length = 236 Score = 27.9 bits (59), Expect = 6.0 Identities = 16/59 (27%), Positives = 28/59 (47%) Frame = -1 Query: 293 VKLSRRLHSWWCPPSIPLSFSFATILPPESKIFGFPEAARRAIVVTSADR*MTYLRLEL 117 VK + WW P ++ L+ S + ++K+F F + R + +R +T LEL Sbjct: 117 VKSNAVCKKWWIPSAVSLATSLVLVFLVQAKLFVFWKVYRGVNRERNDNRTLTRCVLEL 175 >At3g17465.1 68416.m02230 ribosomal protein L3 family protein Length = 324 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 80 RKLEVRRRLDTALVLTVNMSSSDPPTLLQWLGGQLPG 190 RK+ R D V V + DP L W+ GQ+PG Sbjct: 234 RKMAGRMGADQRTVKNVWVYKIDPARNLMWVRGQVPG 270 >At1g13160.1 68414.m01526 SDA1 family protein contains Pfam PF05285: SDA1 domain; similar to mystery 45A (GI:16797816){Drosophila melanogaster} Length = 804 Score = 27.5 bits (58), Expect = 7.9 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = +1 Query: 16 LGSSQENISESICQRCFHQS 75 LG E ++ +IC+ CFH S Sbjct: 215 LGDKNERVAIAICEACFHSS 234 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,474,065 Number of Sequences: 28952 Number of extensions: 313412 Number of successful extensions: 779 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 779 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1314848736 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -