BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0151.Seq (667 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 25 2.8 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 24 3.7 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 24 3.7 DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide... 23 6.5 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 24.6 bits (51), Expect = 2.8 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 3/81 (3%) Frame = -1 Query: 616 SSGTCNNKRSSAQITARLQSI---FSSKGNLHPLLSKTGYIQLLRLQEICRILIVFLVQQ 446 S+G+C K S+ I A Q+ ++S+ + LS + I ++ + E + Sbjct: 846 SAGSCVRKFSTLPILACGQNNVCNYASRNDRTFWLSTSAPIPMMPVTENEMRPYISRCTV 905 Query: 445 CKKLS*LTTAHNQTCHILYCP 383 C+ + + H+QT HI CP Sbjct: 906 CEAPTNVIAVHSQTLHIPECP 926 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 24.2 bits (50), Expect = 3.7 Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -1 Query: 403 CHILYC--PLHIFHLLNLSKIFHDGKWLLRSSYFHHVNATKNYGFHYQYHVQSFSFEGY 233 C LY P+ FH + + +WL + HV ++N+ Q F F G+ Sbjct: 197 CETLYDVNPVPEFHFQSHKEWVPQPQWLEEDQHVFHVVKSRNFDHCEQRMGFHFGFSGF 255 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 24.2 bits (50), Expect = 3.7 Identities = 15/59 (25%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = -1 Query: 403 CHILYC--PLHIFHLLNLSKIFHDGKWLLRSSYFHHVNATKNYGFHYQYHVQSFSFEGY 233 C LY P+ FH + + +WL + HV ++N+ Q F F G+ Sbjct: 197 CETLYDVNPVPEFHFQSHKEWVPQPQWLEEDQHVFHVVKSRNFDHCEQRMGFHFGFSGF 255 >DQ437579-1|ABD96049.1| 575|Anopheles gambiae short neuropeptide F receptor protein. Length = 575 Score = 23.4 bits (48), Expect = 6.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = +2 Query: 140 SLPLFHKEHPEKGGVPPAA 196 SL L H E P G +PPAA Sbjct: 30 SLVLDHTELPLAGTIPPAA 48 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 699,712 Number of Sequences: 2352 Number of extensions: 14974 Number of successful extensions: 26 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 66486645 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -