BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0151.Seq (667 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61840.1 68418.m07759 exostosin family protein contains Pfam ... 35 0.056 At4g38040.1 68417.m05373 exostosin family protein contains Pfam ... 35 0.056 At3g07620.1 68416.m00912 exostosin family protein contains Pfam ... 34 0.074 At5g20260.1 68418.m02412 exostosin family protein contains Pfam ... 34 0.098 At5g11610.1 68418.m01355 exostosin family protein contains Pfam ... 34 0.098 At5g03800.1 68418.m00347 exostosin family protein / pentatricope... 34 0.098 At4g16745.1 68417.m02529 exostosin family protein contains Pfam ... 33 0.13 At5g33290.1 68418.m03948 exostosin family protein contains Pfam ... 33 0.17 At5g37000.1 68418.m04436 exostosin family protein contains Pfam ... 32 0.30 At5g44930.2 68418.m05510 exostosin family protein contains Pfam ... 32 0.39 At5g44930.1 68418.m05509 exostosin family protein contains Pfam ... 32 0.39 At3g42180.2 68416.m04334 exostosin family protein contains Pfam ... 31 0.52 At3g42180.1 68416.m04335 exostosin family protein contains Pfam ... 31 0.52 At2g35100.1 68415.m04306 exostosin family protein contains Pfam ... 31 0.52 At5g25820.1 68418.m03064 exostosin family protein contains Pfam ... 31 0.69 At1g31810.1 68414.m03904 formin homology 2 domain-containing pro... 30 1.2 At1g27440.1 68414.m03345 exostosin family protein contains Pfam ... 30 1.2 At5g19670.1 68418.m02340 exostosin family protein contains Pfam ... 30 1.6 At4g23820.1 68417.m03425 glycoside hydrolase family 28 protein /... 29 2.1 At5g22940.1 68418.m02682 exostosin family protein contains Pfam ... 28 4.9 At4g32790.1 68417.m04665 exostosin family protein contains Pfam ... 28 4.9 At2g31870.1 68415.m03894 poly (ADP-ribose) glycohydrolase (PARG)... 28 4.9 At5g11130.1 68418.m01300 exostosin family protein contains Pfam ... 28 6.4 At2g33850.1 68415.m04155 expressed protein contains 1 transmembr... 28 6.4 At1g73070.1 68414.m08449 leucine-rich repeat family protein cont... 28 6.4 At2g37950.1 68415.m04658 zinc finger (C3HC4-type RING finger) fa... 27 8.5 At2g28110.1 68415.m03415 exostosin family protein contains 1 tra... 27 8.5 >At5g61840.1 68418.m07759 exostosin family protein contains Pfam profile: PF03016 exostosin family ;supported by cDNA gi|23821293|dbj|AB080693.1|; Length = 415 Score = 34.7 bits (76), Expect = 0.056 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERIL 647 PV++++ LPF + I W ++ DE+ + + ++ S+PPE IL Sbjct: 304 PVIIADDIVLPFADAIPWEDIGVFVDEKDVPYLDTILTSIPPEVIL 349 >At4g38040.1 68417.m05373 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 425 Score = 34.7 bits (76), Expect = 0.056 Identities = 12/48 (25%), Positives = 32/48 (66%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILAL 653 PV+LS+ + LPF++ ++WR+ + E+ + + ++++++P ++L Sbjct: 339 PVILSDYYDLPFNDILNWRKFAVVLREQDVYNLKQILKNIPHSEFVSL 386 >At3g07620.1 68416.m00912 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 470 Score = 34.3 bits (75), Expect = 0.074 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 352 WKDLRDERCEEDNKEYDKFDYEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 WK+ + +N D DY +++ S FCI G + S R EA+ +GC Sbjct: 331 WKEKDKDILVYENLP-DGLDYTEMMRKSRFCICPSGHEVASPRVPEAIYSGC 381 Score = 33.1 bits (72), Expect = 0.17 Identities = 12/48 (25%), Positives = 27/48 (56%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILAL 653 PVL+S + LPF + ++W + + + + ++ ++ +P ER + L Sbjct: 383 PVLISENYVLPFSDVLNWEKFSVSVSVKEIPELKRILMDIPEERYMRL 430 >At5g20260.1 68418.m02412 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 334 Score = 33.9 bits (74), Expect = 0.098 Identities = 17/52 (32%), Positives = 26/52 (50%) Frame = +1 Query: 352 WKDLRDERCEEDNKEYDKFDYEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 WKD +DE + DY +L+A + FC+ G + S R + A+ GC Sbjct: 195 WKD-KDEEVQVHEYLAKNKDYFKLMATARFCLCPSGYEVASPRVVAAINLGC 245 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/51 (23%), Positives = 30/51 (58%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILALRQQ 662 PV++S+ + LPF + +DW + I + + ++ +++S+ R L+++ Sbjct: 247 PVIISDHYALPFSDVLDWTKFTIHVPSKKIPEIKTILKSISWRRYRVLQRR 297 >At5g11610.1 68418.m01355 exostosin family protein contains Pfam domain, PF03016: Exostosin family Length = 546 Score = 33.9 bits (74), Expect = 0.098 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +1 Query: 373 RCEEDNKEYDKFD---YEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 R E+D K +++ D Y + + S FC+ A+G + S R +E++ GC Sbjct: 410 RPEQDMKIFNRIDHKSYIRYMKRSRFCVCAKGYEVNSPRVVESILYGC 457 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/51 (21%), Positives = 31/51 (60%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILALRQQ 662 PV++S+ + PF E ++W ++ E+ + + +++ S+P R + ++++ Sbjct: 459 PVIISDNFVPPFLEILNWESFAVFVPEKEIPNLRKILISIPVRRYVEMQKR 509 >At5g03800.1 68418.m00347 exostosin family protein / pentatricopeptide (PPR) repeat-containing protein contains Pfam profiles: PF03016 exostosin family, PF01535 PPR repeat Length = 1388 Score = 33.9 bits (74), Expect = 0.098 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = +1 Query: 412 YEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 Y ++ NS FCI G + S R +EAL +GC Sbjct: 1266 YSDMMRNSKFCICPSGYEVASPRIVEALYSGC 1297 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/48 (22%), Positives = 26/48 (54%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILAL 653 PVL+++G+ PF + ++WR + + + ++ S+ P + L + Sbjct: 1299 PVLINSGYVPPFSDVLNWRSFSVIVSVEDIPNLKTILTSISPRQYLRM 1346 >At4g16745.1 68417.m02529 exostosin family protein contains Pfam PF03016: Exostosin family Length = 542 Score = 33.5 bits (73), Expect = 0.13 Identities = 12/49 (24%), Positives = 29/49 (59%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILALR 656 PV++++ + LPF + +DW + E+ + ++ E++ +P R L ++ Sbjct: 446 PVVIADNFMLPFSDVLDWSAFSVVVPEKEIPRLKEILLEIPMRRYLKMQ 494 >At5g33290.1 68418.m03948 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 500 Score = 33.1 bits (72), Expect = 0.17 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +1 Query: 352 WKDLRDERCEEDNKEYDKFDYEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 WK++ +E D K DY + + S FC+ G + S R +EA+ AGC Sbjct: 360 WKEMDNEVQVYDRLPPGK-DYTKTMGMSKFCLCPSGWEVASPREVEAIYAGC 410 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/48 (25%), Positives = 26/48 (54%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILAL 653 PV++S+ + LPF + ++W I + ++ +++SV R L + Sbjct: 412 PVIISDNYSLPFSDVLNWDSFSIQIPVSRIKEIKTILQSVSLVRYLKM 459 >At5g37000.1 68418.m04436 exostosin family protein contains Pfam domain, PF03016: Exostosin family Length = 547 Score = 32.3 bits (70), Expect = 0.30 Identities = 10/49 (20%), Positives = 30/49 (61%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILALR 656 PV++++ + PF E ++W ++ +E+ + + ++ S+P +R + ++ Sbjct: 480 PVIIADNYVPPFFEVLNWEEFAVFVEEKDIPNLRNILLSIPEDRYIGMQ 528 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = +1 Query: 403 KFDYEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 K Y + + +S +CI ARG + + R +EA+ C Sbjct: 444 KKQYREYMKSSRYCICARGYEVHTPRVVEAIINEC 478 >At5g44930.2 68418.m05510 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 443 Score = 31.9 bits (69), Expect = 0.39 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 3/49 (6%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQ---VPELVRSVPPERIL 647 PV++S+G LPF++ ID+R+ I+ L+ V + +R V P +IL Sbjct: 325 PVIVSDGIELPFEDVIDYRKFSIFLRRDAALKPGFVVKKLRKVKPGKIL 373 >At5g44930.1 68418.m05509 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 443 Score = 31.9 bits (69), Expect = 0.39 Identities = 18/49 (36%), Positives = 30/49 (61%), Gaps = 3/49 (6%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQ---VPELVRSVPPERIL 647 PV++S+G LPF++ ID+R+ I+ L+ V + +R V P +IL Sbjct: 325 PVIVSDGIELPFEDVIDYRKFSIFLRRDAALKPGFVVKKLRKVKPGKIL 373 >At3g42180.2 68416.m04334 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 341 Score = 31.5 bits (68), Expect = 0.52 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 409 DYEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 +Y +L+ +S FC+ G + S R +EA+ +GC Sbjct: 219 NYHELIGHSKFCLCPSGYEVASPREVEAIYSGC 251 Score = 31.5 bits (68), Expect = 0.52 Identities = 10/48 (20%), Positives = 29/48 (60%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILAL 653 PV++S+ + LPF++ +DW + + + + ++++ +P ++ L + Sbjct: 253 PVVISDNYSLPFNDVLDWSKFSVEIPVDKIPDIKKILQEIPHDKYLRM 300 >At3g42180.1 68416.m04335 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 425 Score = 31.5 bits (68), Expect = 0.52 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 409 DYEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 +Y +L+ +S FC+ G + S R +EA+ +GC Sbjct: 303 NYHELIGHSKFCLCPSGYEVASPREVEAIYSGC 335 Score = 31.5 bits (68), Expect = 0.52 Identities = 10/48 (20%), Positives = 29/48 (60%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILAL 653 PV++S+ + LPF++ +DW + + + + ++++ +P ++ L + Sbjct: 337 PVVISDNYSLPFNDVLDWSKFSVEIPVDKIPDIKKILQEIPHDKYLRM 384 >At2g35100.1 68415.m04306 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 447 Score = 31.5 bits (68), Expect = 0.52 Identities = 14/54 (25%), Positives = 34/54 (62%), Gaps = 3/54 (5%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQ---VPELVRSVPPERILALRQQ 662 P+++S+ LPF++ ID+R+ I+ + LQ + +++R + ++IL +++ Sbjct: 329 PLIVSDSIELPFEDVIDYRKFSIFVEANAALQPGFLVQMLRKIKTKKILEYQRE 382 >At5g25820.1 68418.m03064 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 654 Score = 31.1 bits (67), Expect = 0.69 Identities = 12/51 (23%), Positives = 30/51 (58%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILALRQQ 662 PV++S+ + PF E ++W I+ E+ + + +++ S+P R +++ + Sbjct: 567 PVIISDNFVPPFFEVLNWESFAIFIPEKDIPNLKKILMSIPESRYRSMQMR 617 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = +1 Query: 409 DYEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 +Y Q + S +CI A+G + S R +EA+ C Sbjct: 533 NYLQFMKTSKYCICAKGFEVNSPRVVEAIFYDC 565 >At1g31810.1 68414.m03904 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|P48608 Diaphanous protein {Drosophila melanogaster}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1201 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 3/55 (5%) Frame = +2 Query: 77 GEAILARASASEIMFRE---GFDISLPLFHKEHPEKGGVPPAATVNPFPAQRKHL 232 G +LA AS ++FR+ G +L + H+E P KG + + +NPFP+Q ++L Sbjct: 109 GWPLLAFILASFLIFRKVHSGERRTLEIVHREAP-KGLLQLLSPLNPFPSQLRYL 162 >At1g27440.1 68414.m03345 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 412 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/46 (28%), Positives = 27/46 (58%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERIL 647 PV++++ LPF + I W ++ E+ + ++ ++ S+P E IL Sbjct: 301 PVIIADDIVLPFADAIPWEEIGVFVAEKDVPELDTILTSIPTEVIL 346 >At5g19670.1 68418.m02340 exostosin family protein contains Pfam domain, PF03016: Exostosin family Length = 600 Score = 29.9 bits (64), Expect = 1.6 Identities = 11/49 (22%), Positives = 30/49 (61%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILALR 656 PV++S+ + PF E +DW + E+ + ++ +++ S+P ++ + ++ Sbjct: 512 PVIISDNFVPPFFEVLDWSAFSVIVAEKDIPRLKDILLSIPEDKYVKMQ 560 >At4g23820.1 68417.m03425 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein weak similarity to polygalacturonase PG1 [Glycine max] GI:5669846; contains PF00295: Glycosyl hydrolases family 28 Length = 444 Score = 29.5 bits (63), Expect = 2.1 Identities = 18/57 (31%), Positives = 32/57 (56%) Frame = -2 Query: 186 GTPPFSGCSL*NNGNEMSNPSRNIISEALALANIASPGSNPKESSA*SGQVPAYKLN 16 G+ PF+G ++ G+E S +NII+E + L+N+ G N K + G + K++ Sbjct: 279 GSSPFAGIAI---GSETSGGIKNIIAEHITLSNM-GVGVNIKTNIGRGGYIKNIKIS 331 >At5g22940.1 68418.m02682 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 469 Score = 28.3 bits (60), Expect = 4.9 Identities = 11/50 (22%), Positives = 28/50 (56%) Frame = +3 Query: 510 PVLLSNGWRLPFDEKIDWRRAVIWADERLLLQVPELVRSVPPERILALRQ 659 PV++++G +LPF E + W + E+ + + +++ V + A+++ Sbjct: 368 PVVIADGIQLPFSETVQWPEISLTVAEKDVRNLRKVLEHVAATNLSAIQR 417 >At4g32790.1 68417.m04665 exostosin family protein contains Pfam domain, PF03016: Exostosin family Length = 593 Score = 28.3 bits (60), Expect = 4.9 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +1 Query: 391 KEYDKFDYEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 K K Y + + +S +CI +G + S R +EAL C Sbjct: 468 KSKGKKSYMEYMKSSKYCICPKGHEVNSPRVVEALFYEC 506 >At2g31870.1 68415.m03894 poly (ADP-ribose) glycohydrolase (PARG) family protein similar to poly(ADP-ribose) glycohydrolase [Bos taurus] GI:2062407; contains Pfam domain, PF05028: poly (ADP-ribose) glycohydrolase (PARG) Length = 548 Score = 28.3 bits (60), Expect = 4.9 Identities = 17/39 (43%), Positives = 21/39 (53%), Gaps = 6/39 (15%) Frame = +3 Query: 522 SNGWRLPFDEKIDWRRAVIWADE------RLLLQVPELV 620 SNG+ FDE ID + + W DE LLLQ P L+ Sbjct: 72 SNGYAFLFDELIDEKESKRWFDEIIPALASLLLQFPSLL 110 >At5g11130.1 68418.m01300 exostosin family protein contains Pfam profile: PF03016 Exostosin family Length = 336 Score = 27.9 bits (59), Expect = 6.4 Identities = 10/33 (30%), Positives = 20/33 (60%) Frame = +1 Query: 409 DYEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 +Y +++ + FC+ G + S R +E+L +GC Sbjct: 212 NYTKMMDKAKFCLCPSGWEVASPRIVESLYSGC 244 >At2g33850.1 68415.m04155 expressed protein contains 1 transmembrane domain; similar to Protein E6 (Swiss-Prot:Q01197) [Gossypium hirsutum] Length = 267 Score = 27.9 bits (59), Expect = 6.4 Identities = 9/36 (25%), Positives = 20/36 (55%) Frame = -1 Query: 340 DGKWLLRSSYFHHVNATKNYGFHYQYHVQSFSFEGY 233 D +++ Y++ ++ +N+G YQ H ++ GY Sbjct: 202 DTRYMANGKYYYDLDDDRNHGRFYQNHYYNYKPTGY 237 >At1g73070.1 68414.m08449 leucine-rich repeat family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; contains similarity to receptor-like protein kinase INRPK1 [Ipomoea nil] gi|14495542|gb|AAB36558 Length = 598 Score = 27.9 bits (59), Expect = 6.4 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = +1 Query: 235 SLQRKKIVHGIGSETRN--SLWHLHDGNNLILVTTCRHGKSWKDL 363 +L R K+ I E N +L HL+ G+NL+ T +WK+L Sbjct: 534 NLSRNKLTRNIPRELENLQNLSHLNLGSNLLNGTVPSKFSNWKEL 578 >At2g37950.1 68415.m04658 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile PF00097: Zinc finger, C3HC4 type (RING finger); contains PROSITE PS00190: Cytochrome c family heme-binding site signature Length = 207 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -1 Query: 115 YFGSTCSGQYSFTWVKSQRIFSIVWPSAS 29 YF ST G Y + +S+++ S++ PS+S Sbjct: 41 YFYSTTGGSYEYEGDQSRKVSSVMSPSSS 69 >At2g28110.1 68415.m03415 exostosin family protein contains 1 transmembrane domain; similar to pectin-glucuronyltransferase (GI:23821292) [Nicotiana plumbaginifolia]; similar to NpGUT1 homolog (GI:23821294) [Arabidopsis thaliana]; contains Pfam profile PF03016: Exostosin family Length = 448 Score = 27.5 bits (58), Expect = 8.5 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +1 Query: 412 YEQLLANSTFCIVARGRRLGSYRFLEALAAGC 507 Y+ +A S FC+ G S R +E++A GC Sbjct: 321 YQSEIARSVFCLCPLGWAPWSPRLVESVALGC 352 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,667,305 Number of Sequences: 28952 Number of extensions: 312808 Number of successful extensions: 967 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 967 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1403159472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -