BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0149.Seq (623 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 26 0.26 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 25 0.79 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 26.2 bits (55), Expect = 0.26 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +3 Query: 252 KVPPYRRQAAGNGKANGNQTGPGSGRSACACAGIRNTAPGDGVG 383 + PPY R N +Q GSG G R+ +P G+G Sbjct: 79 RFPPYNRMDMRNATYYQHQQDHGSGMD--GMGGYRSASPSPGMG 120 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 24.6 bits (51), Expect = 0.79 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +2 Query: 137 SSSGVPRAPPNCARCRNHRLKIEL 208 S++G PR+P + +RC R KI++ Sbjct: 318 SNNGSPRSPESNSRCSVKREKIKI 341 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,821 Number of Sequences: 438 Number of extensions: 3622 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18582456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -