BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0145.Seq (416 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) 71 5e-13 SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) 57 5e-09 SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 9e-09 SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) 54 6e-08 SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) 51 4e-07 SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 9e-06 SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) 46 1e-05 SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) 46 2e-05 SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 5e-05 SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 9e-05 SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) 38 0.003 SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) 38 0.004 SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) 36 0.013 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 35 0.023 SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.023 SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) 35 0.031 SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) 34 0.041 SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.054 SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.072 SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.095 SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) 33 0.095 SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.17 SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) 32 0.22 SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.22 SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.22 SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) 32 0.22 SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) 31 0.29 SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) 31 0.29 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.29 SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.38 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.50 SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.67 SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) 30 0.88 SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) 29 1.2 SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.5 SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) 29 2.0 SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) 29 2.0 SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) 28 2.7 SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) 28 2.7 SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) 28 3.6 SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) 27 4.7 SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_13046| Best HMM Match : La (HMM E-Value=5e-23) 27 4.7 SB_7579| Best HMM Match : HEAT (HMM E-Value=0.0096) 27 4.7 SB_5101| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.2 SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_16524| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_463| Best HMM Match : RRM_1 (HMM E-Value=3.3e-16) Length = 842 Score = 70.5 bits (165), Expect = 5e-13 Identities = 33/82 (40%), Positives = 54/82 (65%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKI 185 +GE++ V DP T RSRGF F+ FK P+++D V+ +G +++D KK KI Sbjct: 131 FGELKECVVMRDPVTKRSRGFGFLTFKDPKAVDVVLNSGA-----QELDGKKMVTTTKKI 185 Query: 186 FVGGLSSEISDDEIRNFFSEFG 251 F+GGLS+ S+++++ +FS+FG Sbjct: 186 FIGGLSTNTSEEDMKKYFSQFG 207 >SB_8450| Best HMM Match : RRM_1 (HMM E-Value=1.7e-36) Length = 328 Score = 57.2 bits (132), Expect = 5e-09 Identities = 32/80 (40%), Positives = 42/80 (52%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKI 185 YGE+ +++K D TGR RGFAF+ FK D + I K R KI Sbjct: 52 YGELVGVDIKMDALTGRPRGFAFVQFKHQSEADAIDPKPAAPIG------KPPHLRVKKI 105 Query: 186 FVGGLSSEISDDEIRNFFSE 245 FVGGL E SD++IR +F + Sbjct: 106 FVGGLKPETSDEKIREYFGK 125 Score = 53.2 bits (122), Expect = 8e-08 Identities = 22/51 (43%), Positives = 35/51 (68%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 E+E + + N+R+GFCF++F+SE V+ + +T I G +V+VKRA PK Sbjct: 132 EIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRALPK 182 Score = 44.0 bits (99), Expect = 5e-05 Identities = 18/54 (33%), Positives = 31/54 (57%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 AY ++ I T+ ++ R RGF F+ F + +++DK+ H I KV+ K+A Sbjct: 126 AYAPVKEIEYITEHSSNRRRGFCFVSFDSEDTVDKICETQFHNIEGNKVEVKRA 179 Score = 33.9 bits (74), Expect = 0.054 Identities = 12/25 (48%), Positives = 20/25 (80%) Frame = +3 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GK+FVGGLS E + + ++ +FS++G Sbjct: 29 GKLFVGGLSYETTKESLKEYFSKYG 53 >SB_34757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 56.4 bits (130), Expect = 9e-09 Identities = 31/87 (35%), Positives = 46/87 (52%), Gaps = 5/87 (5%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD-----PKKAKA 170 +GEI+ VK DPNT RSRGF F+ FK E V++ H I + + PK+ Sbjct: 138 FGEIDFCEVKLDPNTRRSRGFGFVRFKKDEDAKNVLST-SHRIQGRLCEVRLPRPKEELN 196 Query: 171 RHGKIFVGGLSSEISDDEIRNFFSEFG 251 K+FVG L ++ + +F++FG Sbjct: 197 VPKKLFVGRLPESTTEKTLMEYFAQFG 223 >SB_37500| Best HMM Match : RRM_1 (HMM E-Value=7.3e-38) Length = 496 Score = 53.6 bits (123), Expect = 6e-08 Identities = 23/75 (30%), Positives = 50/75 (66%), Gaps = 11/75 (14%) Frame = +3 Query: 51 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK-----------AKARHGKIFVGG 197 GRSRGF F+ +++ +S+++V+ +H +++++++PK+ A ++ KIFVGG Sbjct: 86 GRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPRDESGAPEAMSKTRKIFVGG 145 Query: 198 LSSEISDDEIRNFFS 242 L+S +++I+ +F+ Sbjct: 146 LASTTVEEDIKEYFN 160 Score = 42.7 bits (96), Expect = 1e-04 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 1/54 (1%) Frame = +3 Query: 9 GEIESINVKTD-PNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 167 GE+ +++K D N R RGFAF+ F E ++KV A H I K+ + KKA+ Sbjct: 169 GEVIDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAE 222 Score = 39.1 bits (87), Expect = 0.001 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +2 Query: 281 KTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 K + +GF F+T+ES VN++LK + +E++ KR+ P+ Sbjct: 83 KRDGRSRGFGFVTYESSDSVNEVLKKKDHVLDDREIEPKRSVPR 126 Score = 35.5 bits (78), Expect = 0.018 Identities = 15/53 (28%), Positives = 33/53 (62%), Gaps = 1/53 (1%) Frame = +2 Query: 257 LEVEMPFDKTKNQR-KGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 ++V++ D+ +R +GF F+TF+++++V + I K+ +VK+A P+ Sbjct: 172 IDVDLKRDRDNPKRIRGFAFVTFDNDEIVEKVCAMKYHEIRMKQCEVKKAEPQ 224 Score = 30.7 bits (66), Expect = 0.50 Identities = 10/25 (40%), Positives = 21/25 (84%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFGT 254 KIF+GGL+ +++ ++++FS++GT Sbjct: 51 KIFIGGLNWNTTEEGLKDYFSQWGT 75 >SB_50249| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 420 Score = 50.8 bits (116), Expect = 4e-07 Identities = 28/82 (34%), Positives = 44/82 (53%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKI 185 +GE+ES+ + G SR + F++FK + K + H IN K VD K++ I Sbjct: 103 FGEVESVRIMRT-FLGYSRNYGFVLFK-DDGPSKEVLKKSHVINGKTVDVGKSR-NFRVI 159 Query: 186 FVGGLSSEISDDEIRNFFSEFG 251 +VGGL S ++ +R F +FG Sbjct: 160 YVGGLPSHFTEQTVREHFKKFG 181 Score = 38.3 bits (85), Expect = 0.003 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 149 YG++ +++ TD TG+S+G + + P +++K++ H I +V Sbjct: 342 YGQVAKVHILTDRETGKSKGCGVVKLRHPGTVNKILEEPVHVIGKSQV 389 Score = 32.3 bits (70), Expect = 0.17 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 135 NNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 N+ PK + +FVGGL+S ++ ++++F +FG Sbjct: 66 NSTLPSPKDIEKNSRSVFVGGLASGTDEEGLKDYFEQFG 104 >SB_6474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 375 Score = 46.4 bits (105), Expect = 9e-06 Identities = 24/85 (28%), Positives = 44/85 (51%), Gaps = 21/85 (24%) Frame = +3 Query: 60 RGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA---------------------KARH 176 +GF F+ F+ P +I+ V+A H ++ K +DPK A A Sbjct: 142 KGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPRGPGQQAQTGAVMGGPQRGSAND 201 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GK+F+GGL+ ++++++ +FS +G Sbjct: 202 GKVFIGGLAFGTTEEDLKEYFSTYG 226 Score = 34.3 bits (75), Expect = 0.041 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = +2 Query: 275 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 F++ KGF F+TF + +L + GK +D K A P+ Sbjct: 134 FERRARMLKGFGFVTFRDPATIESVLAKKPHILDGKTIDPKPAVPR 179 >SB_39934| Best HMM Match : RRM_1 (HMM E-Value=6.5e-24) Length = 343 Score = 46.0 bits (104), Expect = 1e-05 Identities = 25/85 (29%), Positives = 45/85 (52%) Frame = +3 Query: 48 TGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEI 227 +G+S+GFAF+ + E+++ V+ +H I+N V +K + + K+ + + S I + +I Sbjct: 79 SGKSKGFAFVRLRKKEAVESVLGRDDHVIDNSDVSMEK-QDTYRKVILKNIPSSIGESQI 137 Query: 228 RNFFSEFGTS*KWRCPLTKQRTKER 302 FS G P +TKER Sbjct: 138 LEHFSSSGEIASVYIP-ENLKTKER 161 Score = 27.9 bits (59), Expect = 3.6 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 281 KTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEV 388 KTK +RKG C +TF S +++K K I G ++ Sbjct: 157 KTK-ERKGHCIVTFASVTEAFEVVKKRKHHIHGYDI 191 >SB_35971| Best HMM Match : RRM_1 (HMM E-Value=0.013) Length = 665 Score = 45.6 bits (103), Expect = 2e-05 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = +3 Query: 39 DPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 173 D T R RGF F+ F++ S DK H INNKKV+ KKA+ + Sbjct: 5 DKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 Score = 44.4 bits (100), Expect = 4e-05 Identities = 20/46 (43%), Positives = 27/46 (58%) Frame = +2 Query: 275 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 FDK + +GF F+TFESE + T I K+V+VK+A PK Sbjct: 4 FDKATQRHRGFGFVTFESENSADKACDTQYHLINNKKVEVKKAQPK 49 >SB_17242| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 44.0 bits (99), Expect = 5e-05 Identities = 18/49 (36%), Positives = 32/49 (65%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 403 LE++M D+ N+ KG+CF+ F +E +V+ L + GK+V++K+A Sbjct: 133 LEIKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 Score = 41.1 bits (92), Expect = 4e-04 Identities = 26/85 (30%), Positives = 48/85 (56%), Gaps = 12/85 (14%) Frame = +3 Query: 12 EIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAAGE-HTINNKKVDPKKAKARHG-- 179 ++ S+++ P G+SR F F+ F + ID ++ E H+I+NK+V+ K+A R Sbjct: 38 DVSSVSLAKTPE-GKSRKFCFVEFSNGSDIIDNIVFNFESHSIDNKQVEVKRAMPRDDPN 96 Query: 180 --------KIFVGGLSSEISDDEIR 230 K+F+GGL E S+++++ Sbjct: 97 ELAHVRTKKLFIGGLKDEHSEEDVK 121 Score = 28.3 bits (60), Expect = 2.7 Identities = 9/23 (39%), Positives = 17/23 (73%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEF 248 K+FVGGL+ + +++ +R +F F Sbjct: 9 KLFVGGLNEDTTEETVRAYFKSF 31 Score = 28.3 bits (60), Expect = 2.7 Identities = 13/47 (27%), Positives = 22/47 (46%) Frame = +3 Query: 24 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 I + D T + +G+ F+ F +DK+ + K V+ KKA Sbjct: 135 IKMVRDRETNKFKGYCFVNFPNEHIVDKLYLVRHIQVKGKDVEMKKA 181 >SB_17244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 299 Score = 43.2 bits (97), Expect = 9e-05 Identities = 32/91 (35%), Positives = 48/91 (52%), Gaps = 15/91 (16%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVF---KAPESI--DKVMAAGEHTINNKKVDPKKAK 167 AYGE+ + V D T +SRGF ++ F K ++ DKV G H I+ K+V+ K+A Sbjct: 36 AYGELTDVVVICDSATKKSRGFGYVTFADYKVTRNVLKDKV-ENGAHRIDGKEVEVKRAI 94 Query: 168 ARHG----------KIFVGGLSSEISDDEIR 230 R KIFVGGL + + ++I+ Sbjct: 95 PRDDNSATSHEKTKKIFVGGLPEDATKEDIQ 125 Score = 34.7 bits (76), Expect = 0.031 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 4/49 (8%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRT----IGGKEVDVKRATPK 412 D + +GF ++TF +V ++LK I GKEV+VKRA P+ Sbjct: 48 DSATKKSRGFGYVTFADYKVTRNVLKDKVENGAHRIDGKEVEVKRAIPR 96 Score = 33.9 bits (74), Expect = 0.054 Identities = 16/45 (35%), Positives = 27/45 (60%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 D+TK+ +GF F+ +E ++L K + GK V+ K+ATP+ Sbjct: 147 DETKH--RGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPR 189 Score = 29.9 bits (64), Expect = 0.88 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E +++ +R +F +G Sbjct: 15 KLFVGGLNRETTNETLREYFEAYG 38 Score = 27.1 bits (57), Expect = 6.2 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 54 RSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 173 + RGFAF+ + D++ + + K V+ KKA R Sbjct: 150 KHRGFAFVELNNEDQADELCCVKKIHVKGKMVEAKKATPR 189 >SB_31413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 381 Score = 41.9 bits (94), Expect = 2e-04 Identities = 28/87 (32%), Positives = 45/87 (51%), Gaps = 5/87 (5%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK----AKAR- 173 GEI ++ DP TG ++GFAF F S + + T+N+K + P + K+R Sbjct: 177 GEIREFRLQMDPATGLNKGFAFCTFTEQTSAYQAIT----TLNDKDIRPGRRLAICKSRS 232 Query: 174 HGKIFVGGLSSEISDDEIRNFFSEFGT 254 + ++FV G+ S +EI FS+ T Sbjct: 233 NSRLFVKGIPKRKSKEEIFQEFSKVTT 259 >SB_1873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 389 Score = 41.5 bits (93), Expect = 3e-04 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 6/87 (6%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNK--KVD---PKKAKA 170 G + S + D TG+S G+AF+ + P+ +K V + NK KV P + Sbjct: 51 GNVTSCKLIRDRATGQSLGYAFVNYDNPDDANKAVREMNGARLQNKTLKVSFARPSSTEI 110 Query: 171 RHGKIFVGGLSSEISDDEIRNFFSEFG 251 ++ +++ GL ++ ++E+ F FG Sbjct: 111 KNANLYISGLPKDMKEEEVEALFKPFG 137 >SB_41866| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 718 Score = 38.3 bits (85), Expect = 0.003 Identities = 19/58 (32%), Positives = 34/58 (58%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 182 G+I S+ V TDP G+S+GF F+ F+ PE ++ + + +N K++ ++ A K Sbjct: 133 GKIVSLKVMTDPE-GKSKGFGFVSFETPEEAEEAV----NVLNGKEIGGRRLWAGRAK 185 Score = 32.7 bits (71), Expect = 0.12 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 YG I S V D + G S+GF F+ F +PE K + Sbjct: 235 YGTISSAKVMKD-DKGNSKGFGFVCFSSPEEATKAV 269 >SB_1160| Best HMM Match : RRM_1 (HMM E-Value=1.5e-07) Length = 252 Score = 37.5 bits (83), Expect = 0.004 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +3 Query: 18 ESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 E++N+ TD TGR RGF F+ F + E ++K + Sbjct: 123 EAVNIITDRETGRPRGFGFVTFGSKEEMEKAI 154 >SB_37827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 628 Score = 37.5 bits (83), Expect = 0.004 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESI 101 G +E++ + TD NTG+ R F F+ F +P S+ Sbjct: 481 GPLENVRIPTDKNTGQQRSFGFVEFSSPVSV 511 >SB_877| Best HMM Match : RRM_1 (HMM E-Value=1e-15) Length = 145 Score = 35.9 bits (79), Expect = 0.013 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV--DPK 158 YG IE +++ TG+S+GF ++ ++ ES + + AG H I+ K V +PK Sbjct: 86 YGAIEDLSI-IRTQTGKSKGFGYVTYENAESAQRAL-AGTHIIDGKWVIAEPK 136 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 35.1 bits (77), Expect = 0.023 Identities = 12/36 (33%), Positives = 23/36 (63%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 YG ++++++ TD SRGFA++ + PE +K + Sbjct: 1180 YGRVKTVDLPTDRTNNLSRGFAYVEYVDPEECEKAL 1215 Score = 29.5 bits (63), Expect = 1.2 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +2 Query: 263 VEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATP 409 V++P D+T N +GF ++ + + E+ L I G+E+ V+ P Sbjct: 1186 VDLPTDRTNNLSRGFAYVEYVDPEECEKALKHMDGGQIDGQEIAVQSVLP 1235 >SB_23532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 364 Score = 35.1 bits (77), Expect = 0.023 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +3 Query: 21 SINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 S+ V TD TGR RGF F+ F + + +DK + Sbjct: 37 SVKVITDRETGRPRGFGFVTFGSEDEMDKAI 67 Score = 29.1 bits (62), Expect = 1.5 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPK 412 L V++ D+ + +GF F+TF SE ++ + K + G+ + V +A P+ Sbjct: 36 LSVKVITDRETGRPRGFGFVTFGSEDEMDKAIDKFDGEDLDGRPMKVNKAQPR 88 Score = 28.3 bits (60), Expect = 2.7 Identities = 17/68 (25%), Positives = 34/68 (50%), Gaps = 3/68 (4%) Frame = +3 Query: 12 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKV---MAAGEHTINNKKVDPKKAKARHGK 182 ++ + V +D T R RGFAF+ F + ++++ + E + KV+ +++ + G Sbjct: 254 DVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQARSREQRGG 313 Query: 183 IFVGGLSS 206 GG S Sbjct: 314 GRGGGYRS 321 Score = 27.1 bits (57), Expect = 6.2 Identities = 12/53 (22%), Positives = 31/53 (58%), Gaps = 1/53 (1%) Frame = +2 Query: 248 WNFLEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRA 403 ++ ++V++ D+ + +GF F+TF S++ + D + + + G+ + V +A Sbjct: 253 YDVVDVQVISDRETQRPRGFAFVTFGSKKNMEDAINELDGQEFDGRSMKVNQA 305 >SB_15297| Best HMM Match : RRM_1 (HMM E-Value=2.2e-18) Length = 291 Score = 34.7 bits (76), Expect = 0.031 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGG+ E DD +R FF++FG Sbjct: 11 KLFVGGIPYESGDDALRKFFAQFG 34 >SB_28395| Best HMM Match : RRM_1 (HMM E-Value=3.9e-25) Length = 159 Score = 34.3 bits (75), Expect = 0.041 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 12 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 ++ + V TD TGR RGF F+ F + E ++K + Sbjct: 29 DVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAI 62 >SB_8823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1309 Score = 33.9 bits (74), Expect = 0.054 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITF-ESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 EV + D KN+ KGF F++F E + + TIGGK+V A K Sbjct: 541 EVRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARK 592 Score = 31.5 bits (68), Expect = 0.29 Identities = 25/99 (25%), Positives = 44/99 (44%), Gaps = 22/99 (22%) Frame = +3 Query: 24 INVKTDPNTGRSRGFAFIVF-------KAPESIDKVMAAGEHTINN---KKVDPKKAK-- 167 + V DP +S+GF F+ F KA +D V G+ N +K +P + K Sbjct: 542 VRVVKDPAKNKSKGFGFVSFVRREDAAKAIAEMDSVTIGGKQVKTNWAARKNNPTQTKPL 601 Query: 168 ----------ARHGKIFVGGLSSEISDDEIRNFFSEFGT 254 + ++VG L ++ D E++ FS++G+ Sbjct: 602 VWDDVFHQSSQLNTTVYVGNLPPDVKDYELQQMFSQYGS 640 >SB_31414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 610 Score = 33.5 bits (73), Expect = 0.072 Identities = 22/84 (26%), Positives = 37/84 (44%), Gaps = 5/84 (5%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK-----AKAR 173 G I + DP +G ++GFAF F + + ++NK++ P K Sbjct: 176 GHIYDFRLMIDPISGLTKGFAFCTFSNKDEAQNAV----KKLDNKEIRPGKRLGVCISVA 231 Query: 174 HGKIFVGGLSSEISDDEIRNFFSE 245 + ++FVG + S EI FS+ Sbjct: 232 NSRLFVGSIPKTKSKQEILEEFSK 255 >SB_10628| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1208 Score = 33.1 bits (72), Expect = 0.095 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 98 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 Score = 27.1 bits (57), Expect = 6.2 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQ 334 + V + DK ++KGFCF+ +E ++ Sbjct: 6 VNVNLVRDKKTGKQKGFCFLCYEDQR 31 >SB_47564| Best HMM Match : RRM_1 (HMM E-Value=0.23) Length = 44 Score = 33.1 bits (72), Expect = 0.095 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 98 YGEI ++N+ D TG+ +GF F+ ++ S Sbjct: 2 YGEIVNVNLVRDKKTGKQKGFCFLCYEDQRS 32 Score = 27.1 bits (57), Expect = 6.2 Identities = 9/26 (34%), Positives = 17/26 (65%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQ 334 + V + DK ++KGFCF+ +E ++ Sbjct: 6 VNVNLVRDKKTGKQKGFCFLCYEDQR 31 >SB_34062| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 32.3 bits (70), Expect = 0.17 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 2/57 (3%) Frame = +3 Query: 90 PESI-DKVMAAGEHTIN-NKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGT 254 PE++ D+++ + ++N + D + K+FVGGL +I +DEI F FG+ Sbjct: 313 PENLADQIVPSLASSLNCSPNSDSEHIPRFSRKVFVGGLPPDIDEDEIHASFCRFGS 369 >SB_38796| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 382 Score = 31.9 bits (69), Expect = 0.22 Identities = 20/88 (22%), Positives = 39/88 (44%), Gaps = 7/88 (7%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKAKARH--- 176 G + ++++ D T +G+ F+ F E D + + K + KA A + Sbjct: 37 GPVVNVHMPKDRITQLHQGYGFVEFLGEEDADYAIKVMNMIKVYGKPIRVNKASAHNKNL 96 Query: 177 ---GKIFVGGLSSEISDDEIRNFFSEFG 251 +F+G L +E+ + + + FS FG Sbjct: 97 DVGANLFIGNLDTEVDEKLLYDTFSAFG 124 Score = 29.9 bits (64), Expect = 0.88 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +3 Query: 3 AYGEI-ESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN 137 A+G I ++ + D +TG S+GFAFI F + ++ D + A G++ N Sbjct: 122 AFGVILQTPKIMRDSDTGNSKGFAFINFASFDASDAAIEAMNGQYLCN 169 >SB_51113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 871 Score = 31.9 bits (69), Expect = 0.22 Identities = 16/57 (28%), Positives = 27/57 (47%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG 179 G + V +P G SRGFAF+ + E +K G+ N ++V+ + +G Sbjct: 230 GNVTFAQVAINPANGGSRGFAFVDYATAEEAEK----GQRAHNGRQVEGSNIRVAYG 282 >SB_43251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 31.9 bits (69), Expect = 0.22 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 YG++ I + D NT SRGFAF+ F + M Sbjct: 39 YGDLGDIYIPRDRNTHESRGFAFVRFYEKRDAEDAM 74 >SB_2700| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 593 Score = 31.9 bits (69), Expect = 0.22 Identities = 24/111 (21%), Positives = 53/111 (47%), Gaps = 17/111 (15%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPES-------IDKVMAAGEH-----TINNKKV 149 +G I I++ DP + +GFAF+ + PE+ ++ V+ G + N + Sbjct: 125 FGPINKIDLSWDPLNMKHKGFAFVEYDLPEAAQLALEQMNGVLLGGRNIKVGRPSNVPQA 184 Query: 150 DP-----KKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTKQ 287 P ++ ++ +I++ + ++ +D+I++ F FG C L+K+ Sbjct: 185 APLIEQFEQEAKKYARIYIASVHPDLLEDDIKSVFEAFGK--VVHCSLSKE 233 Score = 29.9 bits (64), Expect = 0.88 Identities = 10/39 (25%), Positives = 25/39 (64%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 A+G++ ++ +P TG+ +G+ FI ++ +S + +A+ Sbjct: 221 AFGKVVHCSLSKEPMTGKHKGYGFIEYENQQSANDAIAS 259 Score = 27.5 bits (58), Expect = 4.7 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +2 Query: 293 QRKGFCFITFESEQVVNDLLKTPKR-TIGGKEVDVKRATPKP 415 + KG+ FI +E++Q ND + + +GG+ + V RA P Sbjct: 238 KHKGYGFIEYENQQSANDAIASMNLFDLGGQFLRVGRAITPP 279 >SB_57433| Best HMM Match : RRM_1 (HMM E-Value=4.5e-24) Length = 407 Score = 31.5 bits (68), Expect = 0.29 Identities = 13/71 (18%), Positives = 33/71 (46%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIF 188 G +ES+ + D TG +GF +++F++ +++ + +K+ +K + F Sbjct: 80 GNVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKIRVFPSKDKPQTEF 139 Query: 189 VGGLSSEISDD 221 + + D+ Sbjct: 140 ISHIQVRFRDN 150 Score = 27.1 bits (57), Expect = 6.2 Identities = 16/55 (29%), Positives = 25/55 (45%) Frame = +2 Query: 251 NFLEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 415 N V + D+ KGF ++ FES+ V LK G+++ V + KP Sbjct: 81 NVESVRLIRDRKTGIGKGFGYVLFESKDAVVFALKMNNAEFKGRKIRVFPSKDKP 135 >SB_29577| Best HMM Match : RRM_1 (HMM E-Value=8.5e-15) Length = 171 Score = 31.5 bits (68), Expect = 0.29 Identities = 16/56 (28%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = +3 Query: 141 KKVDPK--KAKARHGKIFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTKQRTKER 302 KK+ PK + + G I++G + ++EI+ FF +FGT + R +K+ + + Sbjct: 84 KKIKPKGDEDELSPGVIYLGHIPHGFFENEIKKFFEQFGTVNRIRLSRSKKSARSK 139 Score = 27.1 bits (57), Expect = 6.2 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 128 +G + I + + RS+G+AF+ F A + + K+ A H Sbjct: 121 FGTVNRIRLSRSKKSARSKGYAFVEF-ACDEVAKIAADTMH 160 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 31.5 bits (68), Expect = 0.29 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 YG++ + + D T SRG AFI+F +S +AA Sbjct: 33 YGKVVKVTILRDKETRESRGVAFILFIDRQSAQNAVAA 70 >SB_46162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 291 Score = 31.1 bits (67), Expect = 0.38 Identities = 10/29 (34%), Positives = 20/29 (68%) Frame = +3 Query: 15 IESINVKTDPNTGRSRGFAFIVFKAPESI 101 +E +++ D +GRSRGF F++ ++ + I Sbjct: 34 VEKVDILRDKESGRSRGFGFVLLQSADQI 62 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 30.7 bits (66), Expect = 0.50 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 KIF+GGL + +++D+++ S FG Sbjct: 674 KIFIGGLPNYLNEDQVKELLSSFG 697 Score = 27.9 bits (59), Expect = 3.6 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAF 74 ++GE+ + N+ D TG S+G+AF Sbjct: 695 SFGELRAFNLVKDSATGLSKGYAF 718 >SB_1585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 721 Score = 30.3 bits (65), Expect = 0.67 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFI---VFKAPESIDKVMAAGEHTINNKKVD 152 YGEI++++V D TG +G+A + FK +S + + E N VD Sbjct: 316 YGEIKNLHVNLDRRTGFIKGYALVEYETFKEAQSALEALNGAEMLGQNISVD 367 >SB_3536| Best HMM Match : RRM_1 (HMM E-Value=0) Length = 1026 Score = 29.9 bits (64), Expect = 0.88 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 +G+I V D T S+G AF+ +++ ES+ + +AA Sbjct: 439 FGDIAYCKVVVDHLTQHSKGSAFVKYRSAESVTQCLAA 476 >SB_33676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 29.5 bits (63), Expect = 1.2 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT 358 +V++ +D + Q KGFCF+T +++ + ++T Sbjct: 303 KVDIMWDWQRQQCKGFCFVTMATQEEAQNAIQT 335 >SB_53534| Best HMM Match : RRM_1 (HMM E-Value=1e-18) Length = 268 Score = 29.5 bits (63), Expect = 1.2 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 +IFV G + E ++ E+R FF E+G Sbjct: 9 RIFVKGFNRETTESELRAFFEEYG 32 Score = 26.6 bits (56), Expect = 8.2 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = +2 Query: 299 KGFCFITFESEQVVNDL 349 KG+ FITFES++V + L Sbjct: 48 KGYAFITFESQEVADGL 64 >SB_18026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 621 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +3 Query: 15 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 I+ + K+ N G++ G AF+VFK+ K + I ++ ++ Sbjct: 361 IDLLKHKSGKNQGKNTGVAFVVFKSNNDASKALKMDRSYIGHRYIE 406 >SB_57661| Best HMM Match : RRM_1 (HMM E-Value=0.017) Length = 255 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFGT 254 K+FVG +S ++++R FS FGT Sbjct: 215 KLFVGMISKHAKEEDLRVMFSPFGT 239 >SB_1157| Best HMM Match : RRM_1 (HMM E-Value=1.2e-11) Length = 248 Score = 28.7 bits (61), Expect = 2.0 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 15 IESINVKTDPNTGRSRGFAFIVFKAPES 98 + + V TD TGR RGF F+ +A ++ Sbjct: 107 VVDVRVITDRETGRPRGFGFVTLEAKKT 134 >SB_48466| Best HMM Match : Pro_isomerase (HMM E-Value=0) Length = 298 Score = 28.3 bits (60), Expect = 2.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPE 95 +G+I + + D T + RGF F+ F+ E Sbjct: 28 FGDITDVQIPMDYTTSKHRGFGFVEFEFAE 57 Score = 28.3 bits (60), Expect = 2.7 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 1/51 (1%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFE-SEQVVNDLLKTPKRTIGGKEVDVKRATP 409 +V++P D T ++ +GF F+ FE +E + + + G+ + V A P Sbjct: 33 DVQIPMDYTTSKHRGFGFVEFEFAEDTAAAIDNMNESELFGRTIRVNLAKP 83 >SB_27005| Best HMM Match : NTF2 (HMM E-Value=1.1e-33) Length = 662 Score = 28.3 bits (60), Expect = 2.7 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFGT 254 ++F+G L S + D ++ FS++GT Sbjct: 358 QVFIGNLPSGVKDADVNEVFSKYGT 382 >SB_47831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 2.7 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +3 Query: 138 NKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 +K + K + K+FVG + ++ E+++FF FG Sbjct: 66 SKDISKYKVVSNKCKVFVGNIGFKVRARELKDFFGYFG 103 >SB_46435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 558 Score = 27.9 bits (59), Expect = 3.6 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 3/39 (7%) Frame = +3 Query: 6 YGEIESINVK---TDPNTGRSRGFAFIVFKAPESIDKVM 113 +GEIE PN G RG+ F+ FK E K + Sbjct: 410 FGEIEHFQFLFHGNGPNRGEPRGYCFVEFKKKEDARKAL 448 >SB_37973| Best HMM Match : ABC_tran (HMM E-Value=0) Length = 3369 Score = 27.9 bits (59), Expect = 3.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -2 Query: 409 WCCTLHIDLLSTNCSFGSLKQIIYNL 332 WC D+L+T CS GS++ ++ L Sbjct: 3068 WCLDCRGDILATGCSDGSVEVVVARL 3093 >SB_24938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 550 Score = 27.9 bits (59), Expect = 3.6 Identities = 8/23 (34%), Positives = 18/23 (78%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFG 251 ++VGGL ++++ ++R+ F +FG Sbjct: 306 LYVGGLEGKVTEQDLRDHFYQFG 328 >SB_46050| Best HMM Match : RRM_1 (HMM E-Value=1.7e-33) Length = 392 Score = 27.5 bits (58), Expect = 4.7 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTKQRTKER 302 +FVG + E S+++++ FSE G +R ++ K + Sbjct: 27 VFVGNIPYEASEEQLKEIFSEVGPVISFRLVFDRETGKPK 66 >SB_971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 783 Score = 27.5 bits (58), Expect = 4.7 Identities = 21/85 (24%), Positives = 41/85 (48%), Gaps = 3/85 (3%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKKVDPKKAKARH 176 +G + +++K P G+ +AF+ F + K A + N+ K+ +++ + Sbjct: 260 FGVVLDVDIKR-PARGQGNTYAFVKFADLDVAAKAKCAMQGQCIGRNHIKIGYGRSQ-QT 317 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 +++VGGL IS E+ F FG Sbjct: 318 TRLWVGGLGPWISIPELEREFDRFG 342 >SB_13046| Best HMM Match : La (HMM E-Value=5e-23) Length = 442 Score = 27.5 bits (58), Expect = 4.7 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQ 334 L V +P K + KGF FI FES+Q Sbjct: 115 LYVSLPRFKHNGEIKGFAFIEFESKQ 140 Score = 27.1 bits (57), Expect = 6.2 Identities = 24/109 (22%), Positives = 49/109 (44%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKI 185 +G++ +++ + G +GFAFI F++ + + V+ KK + K+ + K Sbjct: 111 FGKVLYVSLPRFKHNGEIKGFAFIEFESKQQAEHVVQMFNRESKTKK-EEKREPSIDDKT 169 Query: 186 FVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTKQRTKERASVSSHLNLS 332 + S+ ++ + S+ S R ++RT SV S+ N S Sbjct: 170 KIKKRRRSHSESDLES--SKLSLSQSER---KRRRTTSETSVDSNENAS 213 >SB_7579| Best HMM Match : HEAT (HMM E-Value=0.0096) Length = 1276 Score = 27.5 bits (58), Expect = 4.7 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 393 TSTSFPPIVLLGVLSKSFTTCSDSNVMKQKPFLWFFVLSKG 271 T TS+P ++LLG L + S V ++K LW + L G Sbjct: 177 TKTSYPLLLLLGKLLELIPPLSGEIVEREK--LWHYCLQNG 215 >SB_5101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 262 Score = 27.1 bits (57), Expect = 6.2 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 409 WCCTLHIDLLSTNCSFGSLKQIIYNLLRF 323 WC T +L T+ +F +L +I LRF Sbjct: 127 WCATAGCELSLTDHTFATLPSVIRGFLRF 155 >SB_41429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 26.6 bits (56), Expect = 8.2 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +3 Query: 84 KAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTS 257 K S + + E T KK P K + +F+G LS + ++ + FF E G S Sbjct: 152 KEESSSESDSDSDEETPTPKKTVPAKEEM---SVFLGNLSFDADEETLAAFFEEKGLS 206 >SB_15594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 672 Score = 26.6 bits (56), Expect = 8.2 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -3 Query: 414 GFGVARFTSTSFPPIVLL---GVLSKSFTTCSDSNVMKQKPFLWFFVLSK 274 G G+ R++S S P G +S S+T V ++ FL FFVL K Sbjct: 388 GSGITRYSSLSVPFYCKFSSHGDVSLSYTIKKSVPVWHEEKFLSFFVLYK 437 >SB_16524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 825 Score = 26.6 bits (56), Expect = 8.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 409 WCCTLHIDLLSTNCSFGSLKQIIYNLLRF 323 WC T + TN +F +L +I LRF Sbjct: 373 WCATAGCGVSLTNPAFATLPSVIRGFLRF 401 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,919,295 Number of Sequences: 59808 Number of extensions: 239183 Number of successful extensions: 735 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 728 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -