BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0145.Seq (416 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing ... 66 7e-12 At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing ... 66 7e-12 At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing ... 60 4e-10 At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing ... 56 7e-09 At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing ... 56 7e-09 At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing ... 56 7e-09 At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing ... 56 7e-09 At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein... 55 2e-08 At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing ... 55 2e-08 At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein... 53 7e-08 At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein... 53 7e-08 At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein... 52 1e-07 At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein... 52 1e-07 At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein... 52 1e-07 At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing ... 50 5e-07 At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to... 40 2e-06 At3g19130.1 68416.m02429 RNA-binding protein, putative similar t... 34 1e-05 At1g49760.1 68414.m05580 polyadenylate-binding protein, putative... 44 3e-05 At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein... 44 5e-05 At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing ... 42 1e-04 At4g03110.2 68417.m00421 RNA-binding protein, putative similar t... 42 2e-04 At4g03110.1 68417.m00420 RNA-binding protein, putative similar t... 42 2e-04 At2g23350.1 68415.m02788 polyadenylate-binding protein, putative... 32 3e-04 At1g74230.1 68414.m08597 glycine-rich RNA-binding protein simila... 41 4e-04 At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing ... 40 5e-04 At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing ... 40 9e-04 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 40 9e-04 At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing ... 40 9e-04 At1g03457.1 68414.m00326 RNA-binding protein, putative similar t... 40 9e-04 At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing ... 39 0.001 At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing ... 39 0.001 At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing ... 39 0.002 At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing ... 39 0.002 At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing ... 39 0.002 At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) 39 0.002 At2g36660.1 68415.m04496 polyadenylate-binding protein, putative... 38 0.002 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 38 0.002 At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing ... 38 0.003 At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nea... 38 0.004 At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nea... 38 0.004 At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, ... 35 0.004 At5g61030.1 68418.m07659 RNA-binding protein, putative similar t... 37 0.005 At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing ... 37 0.005 At3g26420.1 68416.m03295 glycine-rich RNA-binding protein simila... 37 0.005 At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7)... 37 0.005 At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7)... 37 0.005 At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative 36 0.008 At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing ... 36 0.008 At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing ... 36 0.011 At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putativ... 36 0.011 At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putativ... 36 0.011 At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonu... 36 0.011 At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC... 36 0.014 At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC... 36 0.014 At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing ... 36 0.014 At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putativ... 35 0.019 At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putat... 35 0.019 At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putat... 35 0.019 At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putativ... 35 0.019 At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing ... 35 0.019 At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing ... 35 0.019 At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5)... 35 0.025 At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putativ... 35 0.025 At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putativ... 35 0.025 At3g16380.1 68416.m02074 polyadenylate-binding protein, putative... 34 0.033 At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing ... 34 0.044 At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing ... 34 0.044 At2g37510.1 68415.m04600 RNA-binding protein, putative similar t... 34 0.044 At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing ... 34 0.044 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 34 0.044 At5g04280.1 68418.m00421 glycine-rich RNA-binding protein 33 0.058 At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) ide... 33 0.058 At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) ide... 33 0.058 At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) ide... 33 0.058 At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, ... 33 0.058 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 33 0.077 At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP... 33 0.077 At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP... 33 0.077 At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP... 33 0.077 At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putat... 33 0.077 At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putat... 33 0.077 At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putat... 33 0.077 At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putativ... 33 0.077 At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containi... 32 0.14 At4g16280.3 68417.m02471 flowering time control protein / FCA ga... 32 0.14 At4g16280.2 68417.m02470 flowering time control protein / FCA ga... 32 0.14 At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profi... 32 0.14 At3g08000.1 68416.m00977 RNA-binding protein, putative similar t... 32 0.14 At1g03457.2 68414.m00327 RNA-binding protein, putative similar t... 32 0.14 At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative simi... 32 0.18 At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing ... 32 0.18 At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing ... 32 0.18 At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing ... 32 0.18 At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, ... 32 0.18 At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, ... 31 0.24 At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2)... 31 0.24 At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-pa... 31 0.24 At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing ... 31 0.31 At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, ... 31 0.31 At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing ... 31 0.31 At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing ... 31 0.31 At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonu... 31 0.31 At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing ... 31 0.41 At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP... 31 0.41 At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast /... 31 0.41 At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast /... 31 0.41 At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2)... 30 0.54 At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2)... 30 0.54 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 30 0.54 At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing ... 30 0.72 At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing ... 30 0.72 At1g72800.1 68414.m08416 nuM1-related contains similarity with n... 30 0.72 At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, ... 30 0.72 At1g51510.1 68414.m05797 RNA-binding protein, putative similar t... 30 0.72 At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 pro... 30 0.72 At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondria... 29 0.95 At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putativ... 29 0.95 At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing ... 29 0.95 At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing ... 29 0.95 At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing ... 29 0.95 At1g60200.1 68414.m06781 splicing factor PWI domain-containing p... 29 0.95 At1g54080.1 68414.m06162 oligouridylate-binding protein, putativ... 29 0.95 At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putat... 29 0.95 At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putat... 29 1.3 At3g11400.1 68416.m01390 eukaryotic translation initiation facto... 29 1.3 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 29 1.7 At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) famil... 29 1.7 At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) famil... 29 1.7 At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing ... 29 1.7 At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing ... 28 2.2 At5g06210.1 68418.m00693 RNA-binding protein, putative contains ... 28 2.2 At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing ... 28 2.2 At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing ... 28 2.2 At1g17370.1 68414.m02118 oligouridylate-binding protein, putativ... 28 2.2 At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing ... 28 2.9 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 28 2.9 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 28 2.9 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 28 2.9 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 28 2.9 At3g46020.1 68416.m04979 RNA-binding protein, putative similar t... 28 2.9 At3g14100.1 68416.m01782 oligouridylate-binding protein, putativ... 28 2.9 At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing ... 28 2.9 At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing ... 27 3.8 At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing ... 27 3.8 At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing ... 27 3.8 At5g06000.1 68418.m00665 eukaryotic translation initiation facto... 27 3.8 At5g03580.1 68418.m00316 polyadenylate-binding protein, putative... 27 3.8 At2g21690.1 68415.m02580 RNA-binding protein, putative similar t... 27 3.8 At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing ... 27 3.8 At1g54080.2 68414.m06163 oligouridylate-binding protein, putativ... 27 3.8 At1g34140.1 68414.m04235 polyadenylate-binding protein, putative... 27 3.8 At5g49760.1 68418.m06163 leucine-rich repeat family protein / pr... 27 5.1 At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing ... 27 5.1 At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 k... 27 5.1 At5g18280.1 68418.m02149 apyrase (APY2) identical to apyrase GI:... 27 6.7 At5g09970.1 68418.m01152 cytochrome P450 family protein 27 6.7 At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein ... 27 6.7 At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing ... 27 6.7 At1g12290.1 68414.m01421 disease resistance protein (CC-NBS-LRR ... 27 6.7 At5g44200.1 68418.m05408 nuclear cap-binding protein, putative s... 26 8.9 At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein ... 26 8.9 At5g04770.1 68418.m00492 amino acid permease family protein simi... 26 8.9 At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30... 26 8.9 At3g04080.1 68416.m00432 apyrase (APY1) identical to apyrase (At... 26 8.9 At2g33440.1 68415.m04099 splicing factor family protein similar ... 26 8.9 At1g62170.1 68414.m07013 serpin family protein / serine protease... 26 8.9 At1g15890.1 68414.m01906 disease resistance protein (CC-NBS-LRR ... 26 8.9 >At3g13224.2 68416.m01658 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 358 Score = 66.5 bits (155), Expect = 7e-12 Identities = 37/93 (39%), Positives = 55/93 (59%), Gaps = 11/93 (11%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KARHG 179 YGEI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K G Sbjct: 42 YGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPKGAGG 100 Query: 180 ---------KIFVGGLSSEISDDEIRNFFSEFG 251 KIFVGG+ S +++DE+++FF+++G Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYG 133 Score = 43.6 bits (98), Expect = 5e-05 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 6/88 (6%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG------EHTINNKKVDPKKAK 167 YG + V D T RSRGF F++F + E +D++++ G + + KK +PKK+ Sbjct: 132 YGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPKKSL 191 Query: 168 ARHGKIFVGGLSSEISDDEIRNFFSEFG 251 R + S+D ++ +G Sbjct: 192 NRSPPSYGSHPRGRSSNDSYASYGGPYG 219 Score = 39.5 bits (88), Expect = 9e-04 Identities = 20/55 (36%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = +2 Query: 251 NFLEVEMPFDKTKNQRKGFCFITFESEQVVNDLL-KTPKRTIGGKEVDVKRATPK 412 N +E ++ D N+ +GF F+ F+SE+VV++LL K + +V++K+A PK Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKGNMIDMADTQVEIKKAEPK 188 Score = 37.9 bits (84), Expect = 0.003 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 D+ Q +GF FITF VV+ +++ I GK+V++KR PK Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK 96 Score = 26.2 bits (55), Expect = 8.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 168 ARHGKIFVGGLSSEISDDEIRNFFSEFG 251 A GKIF+GGL + ++ F ++G Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYG 43 >At3g13224.1 68416.m01657 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 231 Score = 66.5 bits (155), Expect = 7e-12 Identities = 37/93 (39%), Positives = 55/93 (59%), Gaps = 11/93 (11%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA--KARHG 179 YGEI + D +TG+ RGF FI F P +DKV+ H IN K+V+ K+ K G Sbjct: 42 YGEITDSVIMRDRHTGQPRGFGFITFADPSVVDKVI-EDTHVINGKQVEIKRTIPKGAGG 100 Query: 180 ---------KIFVGGLSSEISDDEIRNFFSEFG 251 KIFVGG+ S +++DE+++FF+++G Sbjct: 101 NQSKDIKTKKIFVGGIPSTVTEDELKDFFAKYG 133 Score = 38.3 bits (85), Expect = 0.002 Identities = 15/39 (38%), Positives = 24/39 (61%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG 122 YG + V D T RSRGF F++F + E +D++++ G Sbjct: 132 YGNVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELLSKG 170 Score = 37.9 bits (84), Expect = 0.003 Identities = 18/45 (40%), Positives = 27/45 (60%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 D+ Q +GF FITF VV+ +++ I GK+V++KR PK Sbjct: 53 DRHTGQPRGFGFITFADPSVVDKVIE-DTHVINGKQVEIKRTIPK 96 Score = 32.7 bits (71), Expect = 0.10 Identities = 14/34 (41%), Positives = 24/34 (70%) Frame = +2 Query: 251 NFLEVEMPFDKTKNQRKGFCFITFESEQVVNDLL 352 N +E ++ D N+ +GF F+ F+SE+VV++LL Sbjct: 134 NVVEHQVIRDHETNRSRGFGFVIFDSEEVVDELL 167 Score = 26.2 bits (55), Expect = 8.9 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = +3 Query: 168 ARHGKIFVGGLSSEISDDEIRNFFSEFG 251 A GKIF+GGL + ++ F ++G Sbjct: 16 ASPGKIFIGGLHKDTTNTVFNKHFGKYG 43 >At5g40490.1 68418.m04910 RNA recognition motif (RRM)-containing protein ribonucleoprotein, Xenopus laevis, PIR:S40778; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 423 Score = 60.5 bits (140), Expect = 4e-10 Identities = 34/91 (37%), Positives = 47/91 (51%), Gaps = 9/91 (9%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG-- 179 YGEI + D TG+ RGF F+ + +DKV+ H I K+V+ K+ R Sbjct: 65 YGEITDSVIMKDRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPRGSMS 123 Query: 180 -------KIFVGGLSSEISDDEIRNFFSEFG 251 KIFVGG+ S + DDE + FF +FG Sbjct: 124 SNDFKTKKIFVGGIPSSVDDDEFKEFFMQFG 154 Score = 44.8 bits (101), Expect = 2e-05 Identities = 18/57 (31%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH-TINNKKVDPKKAKAR 173 +GE++ + D +TGRSRGF F+ +++ + +D ++A G ++ +V+ KKA+ + Sbjct: 153 FGELKEHQIMRDHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 39.9 bits (89), Expect = 7e-04 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKR-TIGGKEVDVKRATPK 412 D + + +GF F+T+ESE +V+ LL R + G +V++K+A PK Sbjct: 164 DHSTGRSRGFGFVTYESEDMVDHLLAKGNRIELSGTQVEIKKAEPK 209 Score = 34.3 bits (75), Expect = 0.033 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 D+ Q +GF F+T+ VV+ +++ I GK+V++KR P+ Sbjct: 76 DRKTGQPRGFGFVTYADSSVVDKVIQ-DNHIIIGKQVEIKRTIPR 119 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GKIFVGGL+ E + E F ++G Sbjct: 42 GKIFVGGLARETTSAEFLKHFGKYG 66 >At5g55550.3 68418.m06922 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 56.4 bits (130), Expect = 7e-09 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 25/108 (23%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR---- 173 YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 29 YGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRDDQQ 87 Query: 174 ---------------HG------KIFVGGLSSEISDDEIRNFFSEFGT 254 HG KIFVGGL S I+++E +N+F +FGT Sbjct: 88 VLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGT 135 Score = 46.8 bits (106), Expect = 6e-06 Identities = 21/53 (39%), Positives = 32/53 (60%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 133 FGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 42.7 bits (96), Expect = 1e-04 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK Sbjct: 138 DVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPK 188 Score = 33.1 bits (72), Expect = 0.077 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +3 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GK+F+GG+S + ++ +R++FS +G Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYG 30 >At5g55550.2 68418.m06921 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 460 Score = 56.4 bits (130), Expect = 7e-09 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 25/108 (23%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR---- 173 YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 29 YGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRDDQQ 87 Query: 174 ---------------HG------KIFVGGLSSEISDDEIRNFFSEFGT 254 HG KIFVGGL S I+++E +N+F +FGT Sbjct: 88 VLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGT 135 Score = 46.8 bits (106), Expect = 6e-06 Identities = 21/53 (39%), Positives = 32/53 (60%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 133 FGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 42.7 bits (96), Expect = 1e-04 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK Sbjct: 138 DVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPK 188 Score = 33.1 bits (72), Expect = 0.077 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +3 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GK+F+GG+S + ++ +R++FS +G Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYG 30 >At5g55550.1 68418.m06920 RNA recognition motif (RRM)-containing protein similar to DAZ associated protein 1 [Homo sapiens] GI:8671754; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 448 Score = 56.4 bits (130), Expect = 7e-09 Identities = 39/108 (36%), Positives = 56/108 (51%), Gaps = 25/108 (23%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR---- 173 YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 29 YGDVVEAVIMRDRATGRARGFGFIVFADPCVSERVI-MDKHIIDGRTVEAKKAVPRDDQQ 87 Query: 174 ---------------HG------KIFVGGLSSEISDDEIRNFFSEFGT 254 HG KIFVGGL S I+++E +N+F +FGT Sbjct: 88 VLKRHASPIHLMSPVHGGGGRTKKIFVGGLPSSITEEEFKNYFDQFGT 135 Score = 46.8 bits (106), Expect = 6e-06 Identities = 21/53 (39%), Positives = 32/53 (60%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +G I + V D NT R RGF FI F + +++D+V+ H +N K V+ K+A Sbjct: 133 FGTIADVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRA 185 Score = 42.7 bits (96), Expect = 1e-04 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D + +GF FITF+S+ V+ +L + GK V+VKRA PK Sbjct: 138 DVVVMYDHNTQRPRGFGFITFDSDDAVDRVLHKTFHELNGKLVEVKRAVPK 188 Score = 33.1 bits (72), Expect = 0.077 Identities = 10/25 (40%), Positives = 20/25 (80%) Frame = +3 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GK+F+GG+S + ++ +R++FS +G Sbjct: 6 GKLFIGGISWDTDEERLRDYFSNYG 30 >At1g17640.1 68414.m02183 RNA recognition motif (RRM)-containing protein similar to GB:L02953 from [Xenopus laevis] (Nucleic Acids Res. 21, 999-1006 (1993)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 369 Score = 56.4 bits (130), Expect = 7e-09 Identities = 33/94 (35%), Positives = 51/94 (54%), Gaps = 12/94 (12%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPK--------- 158 +GE+ + TD TG RGF F+ F +KV+ +H I+++KVD K Sbjct: 89 FGEVVDSVIMTDRITGNPRGFGFVTFADSAVAEKVLEE-DHVIDDRKVDLKRTLPRGDKD 147 Query: 159 ---KAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 KA ++ KIFVGGL + +DE++N+F +G Sbjct: 148 TDIKAVSKTRKIFVGGLPPLLEEDELKNYFCVYG 181 Score = 50.4 bits (115), Expect = 5e-07 Identities = 21/57 (36%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKAR 173 YG+I + D +TGRSRGF F+ F+ +S+D++ + G+ H + +K+V+ K+A+ + Sbjct: 180 YGDIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPK 236 Score = 41.5 bits (93), Expect = 2e-04 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 1/55 (1%) Frame = +2 Query: 251 NFLEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 412 + +E ++ +D + +GF F+TF++E V+ L K +G K+V++KRA PK Sbjct: 182 DIIEHQIMYDHHTGRSRGFGFVTFQTEDSVDRLFSDGKVHELGDKQVEIKRAEPK 236 Score = 31.5 bits (68), Expect = 0.24 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +3 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GK+FVGG+S E + + N+F +FG Sbjct: 66 GKLFVGGVSWETTAETFANYFGKFG 90 Score = 29.5 bits (63), Expect = 0.95 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 D+ +GF F+TF V +L+ I ++VD+KR P+ Sbjct: 100 DRITGNPRGFGFVTFADSAVAEKVLE-EDHVIDDRKVDLKRTLPR 143 >At4g14300.1 68417.m02203 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 411 Score = 55.2 bits (127), Expect = 2e-08 Identities = 35/107 (32%), Positives = 53/107 (49%), Gaps = 25/107 (23%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH--- 176 YGE+ V D TGR RGF F++F P +D+V+ +H+I+ ++VD K+A +R Sbjct: 29 YGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKRAMSREEQQ 87 Query: 177 ----------------------GKIFVGGLSSEISDDEIRNFFSEFG 251 KIFVGGL ++D+E R +F +G Sbjct: 88 VSGRTGNLNTSRSSGGDAYNKTKKIFVGGLPPTLTDEEFRQYFEVYG 134 Score = 48.0 bits (109), Expect = 3e-06 Identities = 20/51 (39%), Positives = 34/51 (66%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D+ N+ +GF F++F+SE V+ +L + GK+V+VKRA PK Sbjct: 138 DVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPK 188 Score = 44.4 bits (100), Expect = 3e-05 Identities = 20/66 (30%), Positives = 35/66 (53%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKI 185 YG + + + D T R RGF F+ F + +++D V+ H ++ K+V+ K+A + Sbjct: 133 YGPVTDVAIMYDQATNRPRGFGFVSFDSEDAVDSVLHKTFHDLSGKQVEVKRALPKDANP 192 Query: 186 FVGGLS 203 GG S Sbjct: 193 GGGGRS 198 Score = 33.5 bits (73), Expect = 0.058 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = +3 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GK+FVGG+S E +D++R F+ +G Sbjct: 6 GKLFVGGISWETDEDKLREHFTNYG 30 Score = 33.5 bits (73), Expect = 0.058 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 3/61 (4%) Frame = +2 Query: 230 KLLQ*IWNFLEVEMPF---DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKR 400 KL + N+ EV DK + +GF F+ F V++ +L+ K +I +EVDVKR Sbjct: 21 KLREHFTNYGEVSQAIVMRDKLTGRPRGFGFVIFSDPSVLDRVLQE-KHSIDTREVDVKR 79 Query: 401 A 403 A Sbjct: 80 A 80 >At4g26650.1 68417.m03840 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 455 Score = 54.8 bits (126), Expect = 2e-08 Identities = 39/111 (35%), Positives = 55/111 (49%), Gaps = 28/111 (25%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR---- 173 YG++ + D TGR+RGF FIVF P ++V+ +H I+ + V+ KKA R Sbjct: 38 YGDLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPRDDQQ 96 Query: 174 ---------------HG---------KIFVGGLSSEISDDEIRNFFSEFGT 254 HG KIFVGGL S I++ E +N+F +FGT Sbjct: 97 VLKRHASPMHLISPSHGGNGGGARTKKIFVGGLPSSITEAEFKNYFDQFGT 147 Score = 48.4 bits (110), Expect = 2e-06 Identities = 23/53 (43%), Positives = 31/53 (58%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +G I + V D NT R RGF FI F + ES+D V+ H +N K V+ K+A Sbjct: 145 FGTIADVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRA 197 Score = 44.0 bits (99), Expect = 4e-05 Identities = 21/51 (41%), Positives = 32/51 (62%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D + +GF FITF+SE+ V+ +L + GK V+VKRA PK Sbjct: 150 DVVVMYDHNTQRPRGFGFITFDSEESVDMVLHKTFHELNGKMVEVKRAVPK 200 Score = 32.3 bits (70), Expect = 0.14 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +2 Query: 251 NFLEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 + +E + D+T + +GF FI F V ++ K I G+ V+ K+A P+ Sbjct: 40 DLVEAVIMRDRTTGRARGFGFIVFADPSVAERVI-MDKHIIDGRTVEAKKAVPR 92 Score = 29.9 bits (64), Expect = 0.72 Identities = 8/25 (32%), Positives = 19/25 (76%) Frame = +3 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GK+F+GG+S + ++ ++ +F ++G Sbjct: 15 GKLFIGGISWDTDEERLQEYFGKYG 39 >At5g47620.2 68418.m05879 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 53.2 bits (122), Expect = 7e-08 Identities = 34/104 (32%), Positives = 54/104 (51%), Gaps = 21/104 (20%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG- 179 ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 28 SFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDDH 86 Query: 180 --------------------KIFVGGLSSEISDDEIRNFFSEFG 251 KIFVGGL+S +++ E + +F++FG Sbjct: 87 VVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFG 130 Score = 43.6 bits (98), Expect = 5e-05 Identities = 21/53 (39%), Positives = 30/53 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 129 FGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 40.3 bits (90), Expect = 5e-04 Identities = 18/51 (35%), Positives = 32/51 (62%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 134 DVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 34.3 bits (75), Expect = 0.033 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+F+GG+S E S+D +R++F FG Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFG 30 >At5g47620.1 68418.m05878 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 431 Score = 53.2 bits (122), Expect = 7e-08 Identities = 34/104 (32%), Positives = 54/104 (51%), Gaps = 21/104 (20%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG- 179 ++GE+ + D TGR+RGF F+VF P ++V+ +H I+ K V+ KKA R Sbjct: 28 SFGEVLEAVIMKDRATGRARGFGFVVFADPNVAERVVLL-KHIIDGKIVEAKKAVPRDDH 86 Query: 180 --------------------KIFVGGLSSEISDDEIRNFFSEFG 251 KIFVGGL+S +++ E + +F++FG Sbjct: 87 VVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFG 130 Score = 43.6 bits (98), Expect = 5e-05 Identities = 21/53 (39%), Positives = 30/53 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 129 FGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 181 Score = 40.3 bits (90), Expect = 5e-04 Identities = 18/51 (35%), Positives = 32/51 (62%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 134 DVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 184 Score = 34.3 bits (75), Expect = 0.033 Identities = 12/24 (50%), Positives = 19/24 (79%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+F+GG+S E S+D +R++F FG Sbjct: 7 KLFIGGISWETSEDRLRDYFHSFG 30 >At3g07810.2 68416.m00956 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 495 Score = 52.4 bits (120), Expect = 1e-07 Identities = 32/108 (29%), Positives = 55/108 (50%), Gaps = 23/108 (21%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA------ 164 ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 28 SFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRDDQ 86 Query: 165 -----------------KARHGKIFVGGLSSEISDDEIRNFFSEFGTS 257 R KIFVGGL S +++ + + +F +FGT+ Sbjct: 87 NMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGTT 134 Score = 43.6 bits (98), Expect = 5e-05 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK Sbjct: 136 DVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPK 186 Score = 33.9 bits (74), Expect = 0.044 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 174 HGKIFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTKQRTKERA 305 +GK+F+GG+S + +++ ++ +FS FG + K RT RA Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGE--VIEAVILKDRTTGRA 46 >At3g07810.1 68416.m00955 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 494 Score = 52.4 bits (120), Expect = 1e-07 Identities = 32/108 (29%), Positives = 55/108 (50%), Gaps = 23/108 (21%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA------ 164 ++GE+ + D TGR+RGF F+VF P ++ +++ +H I+ + V+ KKA Sbjct: 28 SFGEVIEAVILKDRTTGRARGFGFVVFADP-AVAEIVITEKHNIDGRLVEAKKAVPRDDQ 86 Query: 165 -----------------KARHGKIFVGGLSSEISDDEIRNFFSEFGTS 257 R KIFVGGL S +++ + + +F +FGT+ Sbjct: 87 NMVNRSNSSSIQGSPGGPGRTRKIFVGGLPSSVTESDFKTYFEQFGTT 134 Score = 43.6 bits (98), Expect = 5e-05 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D + +GF FIT++SE+ V +L + GK V+VKRA PK Sbjct: 136 DVVVMYDHNTQRPRGFGFITYDSEEAVEKVLLKTFHELNGKMVEVKRAVPK 186 Score = 33.9 bits (74), Expect = 0.044 Identities = 15/44 (34%), Positives = 27/44 (61%) Frame = +3 Query: 174 HGKIFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTKQRTKERA 305 +GK+F+GG+S + +++ ++ +FS FG + K RT RA Sbjct: 5 NGKLFIGGISWDTNEERLKEYFSSFGE--VIEAVILKDRTTGRA 46 >At2g33410.1 68415.m04095 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 404 Score = 52.4 bits (120), Expect = 1e-07 Identities = 35/107 (32%), Positives = 51/107 (47%), Gaps = 25/107 (23%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH--- 176 +GE+ + V + TGR RGF F+ F P ID+V+ +H I+N+ VD K+A +R Sbjct: 29 FGEVLQVTVMREKATGRPRGFGFVAFSDPAVIDRVL-QDKHHIDNRDVDVKRAMSREEQS 87 Query: 177 ----------------------GKIFVGGLSSEISDDEIRNFFSEFG 251 KIFVGGL ++ DE R +F +G Sbjct: 88 PAGRSGTFNASRNFDSGANVRTKKIFVGGLPPALTSDEFRAYFETYG 134 Score = 44.4 bits (100), Expect = 3e-05 Identities = 19/53 (35%), Positives = 30/53 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 YG + + D T R RGF F+ F + +S+D V+ H +N K+V+ K+A Sbjct: 133 YGPVSDAVIMIDQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRA 185 Score = 42.3 bits (95), Expect = 1e-04 Identities = 19/45 (42%), Positives = 30/45 (66%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 D+T + +GF F++F+SE V+ +L + GK+V+VKRA PK Sbjct: 144 DQTTQRPRGFGFVSFDSEDSVDLVLHKTFHDLNGKQVEVKRALPK 188 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/49 (34%), Positives = 29/49 (59%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 403 L+V + +K + +GF F+ F V++ +L+ K I ++VDVKRA Sbjct: 33 LQVTVMREKATGRPRGFGFVAFSDPAVIDRVLQD-KHHIDNRDVDVKRA 80 Score = 32.3 bits (70), Expect = 0.14 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 177 GKIFVGGLSSEISDDEIRNFFSEFG 251 GK+F+GG+S + ++ +R +FS FG Sbjct: 6 GKLFIGGISWDTDENLLREYFSNFG 30 >At4g36960.1 68417.m05238 RNA recognition motif (RRM)-containing protein similar to SP|P48809 Heterogeneous nuclear ribonucleoprotein 27C (hnRNP 48) {Drosophila melanogaster}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); non-consensus TA donor splice site at exon 6 Length = 379 Score = 50.4 bits (115), Expect = 5e-07 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 9/91 (9%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH--- 176 +G++E V D +TGRSRGF ++ F + E + GEH + N+ ++ K A + Sbjct: 26 FGDLEDCIVMKDRSTGRSRGFGYVTFASAEDAKNAL-KGEHFLGNRILEVKVATPKEEMR 84 Query: 177 ------GKIFVGGLSSEISDDEIRNFFSEFG 251 +IFV + S +S+ + R+ F +G Sbjct: 85 QPAKKVTRIFVARIPSSVSESDFRSHFERYG 115 Score = 41.1 bits (92), Expect = 3e-04 Identities = 22/51 (43%), Positives = 28/51 (54%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 ++ MP D Q +G FITF S V DL++ +GG V V RATPK Sbjct: 119 DLYMPKDYNSKQHRGIGFITFSSADSVEDLME-DTHDLGGTTVAVDRATPK 168 Score = 31.9 bits (69), Expect = 0.18 Identities = 15/45 (33%), Positives = 28/45 (62%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 D++ + +GF ++TF S + + LK + +G + ++VK ATPK Sbjct: 37 DRSTGRSRGFGYVTFASAEDAKNALK-GEHFLGNRILEVKVATPK 80 Score = 31.5 bits (68), Expect = 0.24 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 KIFVG L E S D++R++F FG Sbjct: 241 KIFVGRLPQEASVDDLRDYFGRFG 264 Score = 31.1 bits (67), Expect = 0.31 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = +2 Query: 269 MPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATP 409 +P D ++ +GF F+TF +E V D + I G+EV + ATP Sbjct: 271 IPKDPKRSGHRGFGFVTF-AENGVADRVARRSHEICGQEVAIDSATP 316 Score = 28.7 bits (61), Expect = 1.7 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 149 +G I+ + DP RGF F+ F D+V A H I ++V Sbjct: 263 FGHIQDAYIPKDPKRSGHRGFGFVTFAENGVADRV-ARRSHEICGQEV 309 >At1g58470.1 68414.m06651 RNA-binding protein (XF41) identical to RNA binding protein GI:18181938 from (Arabidopsis thaliana); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain 15450911 gb AY054536.1 Length = 360 Score = 39.5 bits (88), Expect = 9e-04 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + D N+ +GF F+T++SE V ++++ + K V+VKRA PK Sbjct: 148 DVVVMHDGVTNRPRGFGFVTYDSEDSVEVVMQSNFHELSDKRVEVKRAIPK 198 Score = 35.5 bits (78), Expect(2) = 2e-06 Identities = 14/28 (50%), Positives = 21/28 (75%) Frame = +3 Query: 168 ARHGKIFVGGLSSEISDDEIRNFFSEFG 251 +R KIFVGGLSS +++E +++F FG Sbjct: 117 SRTKKIFVGGLSSNTTEEEFKSYFERFG 144 Score = 32.3 bits (70), Expect(2) = 2e-06 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARH 176 YG + V + TG+ RGF F+ F + K + H I K VD +KA +H Sbjct: 29 YGAVLEAVVAKEKVTGKPRGFGFVRFANDCDVVKAL-RDTHFILGKPVDVRKAIRKH 84 Score = 31.9 bits (69), Expect = 0.18 Identities = 10/24 (41%), Positives = 19/24 (79%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGG++ E S++ ++ +FS +G Sbjct: 7 KLFVGGIAKETSEEALKQYFSRYG 30 >At3g19130.1 68416.m02429 RNA-binding protein, putative similar to RNA Binding Protein 47 [Nicotiana plumbaginifolia] GI:9663769, DNA binding protein ACBF GB:AAC49850 from [Nicotiana tabacum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 435 Score = 33.9 bits (74), Expect(2) = 1e-05 Identities = 19/65 (29%), Positives = 32/65 (49%), Gaps = 2/65 (3%) Frame = +3 Query: 96 SIDKVMAAGEHTINNKKV--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTS*KWR 269 S V+ AG H N ++ + IFVGG+ ++ D+++R FS+FG + Sbjct: 292 SSQAVILAGGHGSNGSMGYGSQSDGESTNATIFVGGIDPDVIDEDLRQPFSQFGEVVSVK 351 Query: 270 CPLTK 284 P+ K Sbjct: 352 IPVGK 356 Score = 31.1 bits (67), Expect(2) = 1e-05 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVF 83 Y ++S V D NTGRS+G+ F+ F Sbjct: 226 YPSVKSAKVVIDSNTGRSKGYGFVRF 251 >At1g49760.1 68414.m05580 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein GB:AAF66825 GI:7673359 from [Nicotiana tabacum] Length = 671 Score = 44.4 bits (100), Expect = 3e-05 Identities = 28/97 (28%), Positives = 47/97 (48%), Gaps = 12/97 (12%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV---------- 149 A+G I S V DP+ G+S+G+ F+ + E+ + +N+K+V Sbjct: 155 AFGPILSCKVAVDPS-GQSKGYGFVQYDTDEAAQGAIDKLNGMLLNDKQVYVGPFVHKLQ 213 Query: 150 -DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTS 257 DP K + ++V LS +SD+E+ F EFG + Sbjct: 214 RDPSGEKVKFTNVYVKNLSESLSDEELNKVFGEFGVT 250 Score = 36.7 bits (81), Expect = 0.006 Identities = 22/89 (24%), Positives = 38/89 (42%), Gaps = 8/89 (8%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM-AAGEHTINNKKV-------DPKKA 164 G++ S+ V D T RS G+ ++ + P+ + + +N + + DP Sbjct: 69 GQVVSVRVCRDMTTRRSLGYGYVNYATPQDASRALNELNFMALNGRAIRVMYSVRDPSLR 128 Query: 165 KARHGKIFVGGLSSEISDDEIRNFFSEFG 251 K+ G IF+ L I + FS FG Sbjct: 129 KSGVGNIFIKNLDKSIDHKALHETFSAFG 157 Score = 29.5 bits (63), Expect = 0.95 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 +G I S V DP+ G SRG F+ F PE + + Sbjct: 350 FGTITSCKVMRDPS-GVSRGSGFVAFSTPEEATRAI 384 Score = 29.1 bits (62), Expect = 1.3 Identities = 10/30 (33%), Positives = 19/30 (63%) Frame = +3 Query: 165 KARHGKIFVGGLSSEISDDEIRNFFSEFGT 254 K++ ++V L ++DD++R F+ FGT Sbjct: 323 KSQGSNLYVKNLDESVTDDKLREHFAPFGT 352 >At5g47620.3 68418.m05877 heterogeneous nuclear ribonucleoprotein, putative / hnRNP, putative Length = 358 Score = 43.6 bits (98), Expect = 5e-05 Identities = 21/53 (39%), Positives = 30/53 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +G I + V D T R RGF FI + + E++DKV+ H +N K V+ K A Sbjct: 56 FGMITDVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLA 108 Score = 40.3 bits (90), Expect = 5e-04 Identities = 18/51 (35%), Positives = 32/51 (62%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +V + +D + +GF FI+++SE+ V+ +L+ + GK V+VK A PK Sbjct: 61 DVVVMYDHRTQRPRGFGFISYDSEEAVDKVLQKTFHELNGKMVEVKLAVPK 111 Score = 35.9 bits (79), Expect = 0.011 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = +3 Query: 105 KVMAAGEHTINNKK---VDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 K + +H + NK + + KIFVGGL+S +++ E + +F++FG Sbjct: 6 KAVPRDDHVVFNKSNSSLQGSPGPSNSKKIFVGGLASSVTEAEFKKYFAQFG 57 >At2g19380.1 68415.m02260 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); contains Pfam profile PF00096: Zinc finger, C2H2 type Length = 613 Score = 42.3 bits (95), Expect = 1e-04 Identities = 20/60 (33%), Positives = 33/60 (55%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 182 +YGEIE +V D +TGR +G+ F++FK + + + E + N+ V A + GK Sbjct: 430 SYGEIEECSVVMDKDTGRGKGYGFVMFKTRKGAREALKRPEKRMYNRIVVCNLASEKPGK 489 >At4g03110.2 68417.m00421 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 439 Score = 41.9 bits (94), Expect = 2e-04 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 8/91 (8%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVDPKK 161 + ++ +N+ D T SRG F++ + E DK++ A G +++ K + Sbjct: 41 FAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYADGE 100 Query: 162 AKARHGKIFVGGLSSEISDDEIRNFFSEFGT 254 + K+FVG L +S+ E+++ FS++GT Sbjct: 101 LERLEHKLFVGMLPKNVSEAEVQSLFSKYGT 131 >At4g03110.1 68417.m00420 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327, CUG-BP and ETR-3 like factor 3 [Homo sapiens] GI:12746392; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 441 Score = 41.9 bits (94), Expect = 2e-04 Identities = 24/91 (26%), Positives = 47/91 (51%), Gaps = 8/91 (8%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--------GEHTINNKKVDPKK 161 + ++ +N+ D T SRG F++ + E DK++ A G +++ K + Sbjct: 41 FAVVDEVNIIKDKITRASRGCCFLLCPSREEADKLVNACHNKKTLPGANSLLQVKYADGE 100 Query: 162 AKARHGKIFVGGLSSEISDDEIRNFFSEFGT 254 + K+FVG L +S+ E+++ FS++GT Sbjct: 101 LERLEHKLFVGMLPKNVSEAEVQSLFSKYGT 131 >At2g23350.1 68415.m02788 polyadenylate-binding protein, putative / PABP, putative Length = 662 Score = 32.3 bits (70), Expect(2) = 3e-04 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKK 161 YG I S V D + G+SR F F+ F+ PE + + A +N KK D K+ Sbjct: 248 YGSISSAVVMRDGD-GKSRCFGFVNFENPEDAARAVEA----LNGKKFDDKE 294 Score = 27.9 bits (59), Expect(2) = 3e-04 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFGT 254 ++V L ++D+++R F+EFGT Sbjct: 330 LYVKNLDDTVTDEKLRELFAEFGT 353 >At1g74230.1 68414.m08597 glycine-rich RNA-binding protein similar to RNA-binding protein GB:S46286 from [Nicotiana sylvestris] Length = 289 Score = 40.7 bits (91), Expect = 4e-04 Identities = 18/56 (32%), Positives = 27/56 (48%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKAR 173 YGE+ + D TGRSRGFAF+ F + E M ++ +++ A R Sbjct: 57 YGEVVDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/52 (21%), Positives = 29/52 (55%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPK 412 ++ ++ D+ + +GF F+TF S + ++ ++ + + G+ + V AT + Sbjct: 61 VDAKIIVDRETGRSRGFAFVTFTSTEEASNAMQLDGQDLHGRRIRVNYATER 112 Score = 26.6 bits (56), Expect = 6.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 KIFVGG+S + +R FS++G Sbjct: 35 KIFVGGISYSTDEFGLREAFSKYG 58 >At1g76460.1 68414.m08893 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 285 Score = 40.3 bits (90), Expect = 5e-04 Identities = 18/49 (36%), Positives = 28/49 (57%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 YGEI V D NTGRS+G+ F+ F+ PE+ + A I+ ++ + Sbjct: 47 YGEILEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRAN 95 Score = 28.3 bits (60), Expect = 2.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E + +R F ++G Sbjct: 25 KVFVGGLAWETQSETLRQHFEQYG 48 Score = 27.1 bits (57), Expect = 5.1 Identities = 15/56 (26%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKP 415 LE + DK + KG+ F+TF + P I G+ + A+ P+P Sbjct: 51 LEAVVIADKNTGRSKGYGFVTFRDPEAARRACADPTPIIDGRRANCNLASLGRPRP 106 >At1g78260.2 68414.m09119 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 271 Score = 39.5 bits (88), Expect = 9e-04 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 40 FGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 33.9 bits (74), Expect = 0.044 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E DE+R +F +FG Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFG 41 Score = 27.5 bits (58), Expect = 3.8 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKP 415 LE + DK + KG+ F+TF + P I G++ + A+ P+P Sbjct: 44 LEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRP 99 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 39.5 bits (88), Expect = 9e-04 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +GEI + TD NTG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 40 FGEILEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKAN 88 Score = 33.9 bits (74), Expect = 0.044 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E DE+R +F +FG Sbjct: 18 KVFVGGLAWETPTDEMRRYFEQFG 41 Score = 27.5 bits (58), Expect = 3.8 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKP 415 LE + DK + KG+ F+TF + P I G++ + A+ P+P Sbjct: 44 LEAVIITDKNTGKSKGYGFVTFRESDSATRAVADPNPVIDGRKANCNIASFGRPRP 99 >At1g20880.1 68414.m02615 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); is the location of EST 197B1T7 , gb|AA597386 Length = 274 Score = 39.5 bits (88), Expect = 9e-04 Identities = 16/31 (51%), Positives = 22/31 (70%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 98 YG+I V TD NTGRS+G+ F+ F+ PE+ Sbjct: 47 YGDILEAVVITDKNTGRSKGYGFVTFRDPEA 77 Score = 28.3 bits (60), Expect = 2.2 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E + +R F ++G Sbjct: 25 KVFVGGLAWETQSETLRRHFDQYG 48 Score = 26.6 bits (56), Expect = 6.7 Identities = 13/52 (25%), Positives = 22/52 (42%) Frame = +2 Query: 251 NFLEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 406 + LE + DK + KG+ F+TF + P I G+ + A+ Sbjct: 49 DILEAVVITDKNTGRSKGYGFVTFRDPEAARRACVDPTPIIDGRRANCNLAS 100 >At1g03457.1 68414.m00326 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 429 Score = 39.5 bits (88), Expect = 9e-04 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 12/92 (13%) Frame = +3 Query: 15 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKKAKARHG 179 + +N+ + T RG F+ E DKV+ ++ +NKK P + K G Sbjct: 38 VNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQVKYADG 93 Query: 180 -------KIFVGGLSSEISDDEIRNFFSEFGT 254 K+FVG L +S+ E+++ FSE+GT Sbjct: 94 ELERLEHKLFVGMLPKNVSETEVQSLFSEYGT 125 >At5g53720.1 68418.m06676 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 100 Score = 39.1 bits (87), Expect = 0.001 Identities = 20/53 (37%), Positives = 28/53 (52%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +GEI V D T RS+GF F+ F+ ES + HTI+ + V+ K A Sbjct: 32 FGEIVYAKVVCDGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 Score = 30.3 bits (65), Expect = 0.54 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 403 D + KGF F+TF + + P TI G+ V+ K A Sbjct: 43 DGATQRSKGFGFVTFREVESATRACENPNHTIDGRTVNCKLA 84 >At2g41060.1 68415.m05070 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 451 Score = 39.1 bits (87), Expect = 0.001 Identities = 28/101 (27%), Positives = 45/101 (44%), Gaps = 19/101 (18%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV------------ 149 YGEIE D +G+S+G+ FI+FK+ + + I + Sbjct: 151 YGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARNALKQPQKKIGTRMTACQLASIGPVQG 210 Query: 150 DPKKAKARH-------GKIFVGGLSSEISDDEIRNFFSEFG 251 +P A A+H KI+V +S++I ++ FFS FG Sbjct: 211 NPVVAPAQHFNPENVQRKIYVSNVSADIDPQKLLEFFSRFG 251 Score = 33.9 bits (74), Expect = 0.044 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +GEIE + D TGR +GFA V+++ ES K + T + KA Sbjct: 250 FGEIEEGPLGLDKATGRPKGFALFVYRSLESAKKALEEPHKTFEGHVLHCHKA 302 >At4g00830.1 68417.m00114 RNA recognition motif (RRM)-containing protein similar to nucleolin protein; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 495 Score = 38.7 bits (86), Expect = 0.002 Identities = 19/81 (23%), Positives = 35/81 (43%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIF 188 GEI + + D ++G S+G+AF+ FK + K + K ++F Sbjct: 140 GEIFEVRLMKDRDSGDSKGYAFVAFKTKDVAQKAIEELHSKEFKGKTIRCSLSETKNRLF 199 Query: 189 VGGLSSEISDDEIRNFFSEFG 251 +G + ++DE R + G Sbjct: 200 IGNIPKNWTEDEFRKVIEDVG 220 Score = 28.7 bits (61), Expect = 1.7 Identities = 12/24 (50%), Positives = 19/24 (79%), Gaps = 1/24 (4%) Frame = +3 Query: 15 IESINVKTDP-NTGRSRGFAFIVF 83 +E+I + DP NT R+RGFAF+++ Sbjct: 223 VENIELIKDPTNTTRNRGFAFVLY 246 Score = 27.5 bits (58), Expect = 3.8 Identities = 9/27 (33%), Positives = 19/27 (70%), Gaps = 1/27 (3%) Frame = +3 Query: 174 HG-KIFVGGLSSEISDDEIRNFFSEFG 251 HG ++F+GGL ++ ++++R+ E G Sbjct: 114 HGSEVFIGGLPRDVGEEDLRDLCEEIG 140 >At3g15010.2 68416.m01899 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 38.7 bits (86), Expect = 0.002 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 189 AYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 33.5 bits (73), Expect = 0.058 Identities = 21/79 (26%), Positives = 39/79 (49%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 182 +YG++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 97 SYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQLAA 151 Query: 183 IFVGGLSSEISDDEIRNFF 239 G S+I+D +R + Sbjct: 152 SGNQGTGSQIADISMRKIY 170 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 403 E + FDK + +GF +++ + L P + I GK ++ K A Sbjct: 195 EGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 >At3g15010.1 68416.m01898 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 404 Score = 38.7 bits (86), Expect = 0.002 Identities = 20/54 (37%), Positives = 29/54 (53%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 AYG++E + D TG+SRGFA V+K E +A I+ K ++ K A Sbjct: 189 AYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 Score = 33.5 bits (73), Expect = 0.058 Identities = 21/79 (26%), Positives = 39/79 (49%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 182 +YG++E V D TG+S+G+ F+ F +D + A + +KK+D + + Sbjct: 97 SYGDLEEAIVILDKVTGKSKGYGFVTFM---HVDGALLALKEP--SKKIDGRVTVTQLAA 151 Query: 183 IFVGGLSSEISDDEIRNFF 239 G S+I+D +R + Sbjct: 152 SGNQGTGSQIADISMRKIY 170 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRA 403 E + FDK + +GF +++ + L P + I GK ++ K A Sbjct: 195 EGPLGFDKVTGKSRGFALFVYKTAEGAQAALADPVKVIDGKHLNCKLA 242 >At1g22760.1 68414.m02844 polyadenylate-binding protein 3 (PABP3) Length = 660 Score = 38.7 bits (86), Expect = 0.002 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 14/97 (14%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPES----IDKV--MAAGE------HTINNKK 146 ++G I S V D TGRS+G+ F+ F+ ES IDK+ M + H I ++ Sbjct: 158 SFGTILSCKVAMDV-TGRSKGYGFVQFEKEESAQAAIDKLNGMLMNDKQVFVGHFIRRQE 216 Query: 147 V--DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 D R ++V L EI +DE+R F +FG Sbjct: 217 RARDENTPTPRFTNVYVKNLPKEIGEDELRKTFGKFG 253 Score = 35.5 bits (78), Expect = 0.014 Identities = 27/88 (30%), Positives = 38/88 (43%), Gaps = 8/88 (9%) Frame = +3 Query: 15 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT--------INNKKVDPKKAKA 170 + S+ V D N RS G+A+I F P + M A +T I DP + Sbjct: 75 VVSVRVCRDQNR-RSLGYAYINFSNPNDAYRAMEALNYTPLFDRPIRIMLSNRDPSTRLS 133 Query: 171 RHGKIFVGGLSSEISDDEIRNFFSEFGT 254 G IF+ L + I + + FS FGT Sbjct: 134 GKGNIFIKNLDASIDNKALFETFSSFGT 161 Score = 29.9 bits (64), Expect = 0.72 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPE 95 YG + S V +P G SRGF F+ + PE Sbjct: 355 YGNVTSSKVMLNPQ-GMSRGFGFVAYSNPE 383 >At2g36660.1 68415.m04496 polyadenylate-binding protein, putative / PABP, putative Length = 609 Score = 38.3 bits (85), Expect = 0.002 Identities = 25/92 (27%), Positives = 49/92 (53%), Gaps = 10/92 (10%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEHTINNK---KVDP 155 +G I S V T + G+SRG+ F+ F+ A ++++ + A + K K D Sbjct: 135 FGNIVSCKVATLED-GKSRGYGFVQFEQEDAAHAAIQTLNSTIVADKEIYVGKFMKKTDR 193 Query: 156 KKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 K + ++ +++ L +++S+D +R F+EFG Sbjct: 194 VKPEEKYTNLYMKNLDADVSEDLLREKFAEFG 225 Score = 27.9 bits (59), Expect = 2.9 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAP-ESIDKV 110 G I S + D G+S+GF F+ F P E+ID V Sbjct: 328 GTITSTKLMCDEK-GKSKGFGFVCFSTPEEAIDAV 361 Score = 27.1 bits (57), Expect = 5.1 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = +3 Query: 141 KKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGT 254 +K + +K A+ I+V ++ ++++E+R FS+ GT Sbjct: 292 EKHEEQKMIAKVSNIYVKNVNVAVTEEELRKHFSQCGT 329 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 38.3 bits (85), Expect = 0.002 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 149 YGEI +V D +TGR++GF F++FK + + E + N+ V Sbjct: 186 YGEITECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTV 233 Score = 29.5 bits (63), Expect = 0.95 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATP 409 E + DK + KGF F+ F++ + LK P++ + + V A P Sbjct: 191 ECSVVMDKDTGRAKGFGFVLFKTRKGARAALKNPEKRMYNRTVSCLPARP 240 >At2g46780.1 68415.m05836 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 304 Score = 37.9 bits (84), Expect = 0.003 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 98 +GEI V TD NTGRS+G+ F+ FK E+ Sbjct: 45 FGEIVEAVVITDKNTGRSKGYGFVTFKEAEA 75 Score = 31.9 bits (69), Expect = 0.18 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 KIFVGGL+ E D +R +F +FG Sbjct: 23 KIFVGGLAWETQRDTMRRYFEQFG 46 >At2g22090.2 68415.m02624 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 347 Score = 37.5 bits (83), Expect = 0.004 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 143 YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 127 YGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 31.5 bits (68), Expect = 0.24 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 415 E + DK + KGF F+ F++ + + LK PK+ I + + A+ P Sbjct: 132 ECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGP 183 >At2g22090.1 68415.m02623 UBP1 interacting protein 1a (UBA1a) nearly identical to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); based on cDNA of partial mRNA for UBP1 interacting protein 1a (uba1a) GI:19574235 Length = 343 Score = 37.5 bits (83), Expect = 0.004 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNK 143 YGEIE V D TG+++GF F++FK + + + + I N+ Sbjct: 127 YGEIEECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNR 172 Score = 31.5 bits (68), Expect = 0.24 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 415 E + DK + KGF F+ F++ + + LK PK+ I + + A+ P Sbjct: 132 ECTVVIDKATGKAKGFGFVMFKTRKGAKEALKEPKKRILNRTATCQLASMGP 183 >At2g37220.1 68415.m04566 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 289 Score = 35.1 bits (77), Expect = 0.019 Identities = 15/54 (27%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKT-PKRTIGGKEVDVKRATPKP 415 +E + +D+ + KGF F+T++S Q V + +K+ + G+++ V A +P Sbjct: 231 VEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEARP 284 Score = 33.5 bits (73), Expect(2) = 0.004 Identities = 19/57 (33%), Positives = 29/57 (50%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHG 179 G +E + V D TGRSRGF F+ S+ +V AA + N ++D + + G Sbjct: 115 GNVEMVEVIYDKITGRSRGFGFVTM---SSVSEVEAAAQQ-FNGYELDGRPLRVNAG 167 Score = 29.5 bits (63), Expect = 0.95 Identities = 12/56 (21%), Positives = 32/56 (57%), Gaps = 1/56 (1%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKVDPKKAKAR 173 G++ V D ++GRS+GF F+ + + + + + + + ++ +++ +A+AR Sbjct: 228 GKVVEARVIYDRDSGRSKGFGFVTYDSSQEVQNAIKSLDGADLDGRQIRVSEAEAR 283 Score = 23.0 bits (47), Expect(2) = 0.004 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 +++VG LS + D + + FSE G Sbjct: 205 RVYVGNLSWGVDDMALESLFSEQG 228 >At5g61030.1 68418.m07659 RNA-binding protein, putative similar to RNA-binding protein from [Solanum tuberosum] GI:15822705, [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 309 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 YGE+ V D TGRSRGF F+ F + E+ + A Sbjct: 63 YGEVVDTRVILDRETGRSRGFGFVTFTSSEAASSAIQA 100 Score = 29.1 bits (62), Expect = 1.3 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTKQRTKER 302 K+F+GG++ + +D +R F+++G R L ++ + R Sbjct: 41 KLFIGGMAYSMDEDSLREAFTKYGEVVDTRVILDRETGRSR 81 >At5g53680.1 68418.m06668 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 169 Score = 37.1 bits (82), Expect = 0.005 Identities = 19/53 (35%), Positives = 27/53 (50%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +GEI +NV D T RS+G+ F+ FK ES + TI + + K A Sbjct: 36 FGEIIHVNVVCDRETDRSQGYGFVTFKDAESATRACKDPNPTIEGRITNCKLA 88 >At3g26420.1 68416.m03295 glycine-rich RNA-binding protein similar to RNA-binding protein (RZ-1) GB:BAA12064 [Nicotiana sylvestris]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 245 Score = 37.1 bits (82), Expect = 0.005 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-GEHTINNKKVDPKKAKARHG 179 YG + V D +GRSRGF FI F +++D+ +AA ++ + + KA+ G Sbjct: 30 YGHLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQPHQG 88 Score = 30.7 bits (66), Expect = 0.41 Identities = 13/54 (24%), Positives = 30/54 (55%), Gaps = 1/54 (1%) Frame = +2 Query: 251 NFLEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATP 409 + +E ++ DK + +GF FITF+ ++ +++ + + G+ + V +A P Sbjct: 32 HLVEAKVVLDKFSGRSRGFGFITFDEKKAMDEAIAAMNGMDLDGRTITVDKAQP 85 >At2g21660.2 68415.m02578 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 159 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKAR 173 YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++R Sbjct: 31 YGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87 Score = 27.1 bits (57), Expect = 5.1 Identities = 11/43 (25%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 403 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A Sbjct: 42 DRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEA 84 >At2g21660.1 68415.m02577 glycine-rich RNA-binding protein (GRP7) SP|Q03250 Glycine-rich RNA-binding protein 7 {Arabidopsis thaliana} Length = 176 Score = 37.1 bits (82), Expect = 0.005 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKAR 173 YG++ + D TGRSRGF F+ FK +++ D + ++ + + +A++R Sbjct: 31 YGDVIDSKIINDRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEAQSR 87 Score = 27.1 bits (57), Expect = 5.1 Identities = 11/43 (25%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 403 D+ + +GF F+TF+ E+ + D ++ + + G+ + V A Sbjct: 42 DRETGRSRGFGFVTFKDEKAMKDAIEGMNGQDLDGRSITVNEA 84 >At5g19350.1 68418.m02306 RNA-binding protein 45 (RBP45), putative Length = 425 Score = 36.3 bits (80), Expect = 0.008 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 116 Y + V TDP+TGRS+G+ F+ F ++ MA Sbjct: 140 YSSVRGAKVVTDPSTGRSKGYGFVKFAEESERNRAMA 176 >At1g22330.1 68414.m02793 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 36.3 bits (80), Expect = 0.008 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +3 Query: 174 HGKIFVGGLSSEISDDEIRNFFSEFG 251 H K+FVGGL+ E DE+R +F +FG Sbjct: 16 HTKVFVGGLAWETPTDEMRRYFDQFG 41 Score = 35.9 bits (79), Expect = 0.011 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +GEI + TD TG+S+G+ F+ F+ +S + +A I+ +K + Sbjct: 40 FGEILEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKAN 88 Score = 27.5 bits (58), Expect = 3.8 Identities = 15/56 (26%), Positives = 25/56 (44%), Gaps = 3/56 (5%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT---PKP 415 LE + DK + KG+ F+TF + P I G++ + A+ P+P Sbjct: 44 LEAVIITDKATGKSKGYGFVTFRDSDSATRAVADPNPVIDGRKANCNIASFGRPRP 99 >At3g47120.1 68416.m05116 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 352 Score = 35.9 bits (79), Expect = 0.011 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPES 98 YGEI +N+ D TG+S+GFAF+ ++ S Sbjct: 59 YGEIVDVNLIRDKGTGKSKGFAFLAYEDQRS 89 >At1g47490.2 68414.m05269 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 310 Score = 35.9 bits (79), Expect = 0.011 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%) Frame = +3 Query: 12 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP-----------K 158 EI S+ V + N G S G+ F+ F++ + DKV+ T P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 159 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 245 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 30.3 bits (65), Expect = 0.54 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At1g47490.1 68414.m05270 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 432 Score = 35.9 bits (79), Expect = 0.011 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 14/92 (15%) Frame = +3 Query: 12 EIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDP-----------K 158 EI S+ V + N G S G+ F+ F++ + DKV+ T P + Sbjct: 128 EIVSVKVIRNKNNGLSEGYGFVEFESHDVADKVLREFNGTTMPNTDQPFRLNWASFSTGE 187 Query: 159 KAKARHG---KIFVGGLSSEISDDEIRNFFSE 245 K +G IFVG LS ++SD+ + FSE Sbjct: 188 KRLENNGPDLSIFVGDLSPDVSDNLLHETFSE 219 Score = 33.9 bits (74), Expect = 0.044 Identities = 14/34 (41%), Positives = 23/34 (67%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTK 284 IFVGGL S ++D++++ F+EFG + P+ K Sbjct: 306 IFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGK 339 Score = 30.3 bits (65), Expect = 0.54 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 221 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 256 >At1g07350.1 68414.m00783 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 382 Score = 35.9 bits (79), Expect = 0.011 Identities = 16/59 (27%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI-NNKKVDPKKAKARHGK 182 G++ +++ DP T SRGF FI K+ ++ + + +H++ + + +KA+ R G+ Sbjct: 99 GKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRVITVEKARRRRGR 157 >At5g64200.2 68418.m08063 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 35.5 bits (78), Expect = 0.014 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 8/68 (11%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVDPKK 161 YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K P Sbjct: 39 YGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNA 98 Query: 162 AKARHGKI 185 K G++ Sbjct: 99 EKISKGRV 106 >At5g64200.1 68418.m08062 arginine/serine-rich splicing factor SC35 contains similarity to splicing factor; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 303 Score = 35.5 bits (78), Expect = 0.014 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 8/68 (11%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVF-------KAPESID-KVMAAGEHTINNKKVDPKK 161 YG++ + + D TG SRGFAF+ + KA E +D +V+ E T+ K P Sbjct: 39 YGKVVDVFIPRDRRTGDSRGFAFVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNA 98 Query: 162 AKARHGKI 185 K G++ Sbjct: 99 EKISKGRV 106 >At3g52660.1 68416.m05801 RNA recognition motif (RRM)-containing protein heterogeneous nuclear ribonucleoprotein R, Homo sapiens, PIR:T02673; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 471 Score = 35.5 bits (78), Expect = 0.014 Identities = 14/82 (17%), Positives = 41/82 (50%), Gaps = 1/82 (1%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPE-SIDKVMAAGEHTINNKKVDPKKAKARHGKI 185 GE+ + + + ++G +G+AF+ F++ + + + + K++ +A+H ++ Sbjct: 116 GEVTEVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRIKCSTTQAKH-RL 174 Query: 186 FVGGLSSEISDDEIRNFFSEFG 251 F+G + + +I+ + G Sbjct: 175 FLGNVPRNWMESDIKKAANRIG 196 Score = 27.1 bits (57), Expect = 5.1 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRT-IGGKEV 388 EV + +K KG+ F+TF S+ + + + T T GK + Sbjct: 120 EVRIMREKDSGDGKGYAFVTFRSKDLAAEAIDTLNNTDFRGKRI 163 >At5g54900.1 68418.m06838 RNA-binding protein 45 (RBP45), putative contains similarity to polyadenylate-binding protein 5 Length = 387 Score = 35.1 bits (77), Expect = 0.019 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFG 251 IFVGGL + ++DDE+++ F +FG Sbjct: 262 IFVGGLDANVTDDELKSIFGQFG 284 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVF 83 YG ++ V D TGRS+G+ F+ F Sbjct: 178 YGSVKGAKVVLDRTTGRSKGYGFVRF 203 >At3g23830.2 68416.m02996 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 35.1 bits (77), Expect = 0.019 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 57 SFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGLS D ++ F+ FG Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFG 59 >At3g23830.1 68416.m02995 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana]; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 136 Score = 35.1 bits (77), Expect = 0.019 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 ++GE+ V D TGRSRGF F+ F +S + + Sbjct: 57 SFGEVTEATVIADRETGRSRGFGFVSFSCEDSANNAI 93 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGLS D ++ F+ FG Sbjct: 36 KLFVGGLSWGTDDSSLKQAFTSFG 59 >At1g47500.1 68414.m05272 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein GI:1899187 from [Nicotiana tabacum] Length = 434 Score = 35.1 bits (77), Expect = 0.019 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTK 284 IFVGGL S ++D++++ FSEFG + P+ K Sbjct: 308 IFVGGLDSSVTDEDLKQPFSEFGEIVSVKIPVGK 341 Score = 30.3 bits (65), Expect = 0.54 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 Y +++ V D NTGRS+G+ F+ F K M Sbjct: 223 YPSVKAAKVVLDANTGRSKGYGFVRFGDENERTKAM 258 >At1g33470.2 68414.m04143 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 244 Score = 35.1 bits (77), Expect = 0.019 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 30 FGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 31.1 bits (67), Expect = 0.31 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E +RN+F +FG Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFG 31 >At1g33470.1 68414.m04142 RNA recognition motif (RRM)-containing protein similar to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 245 Score = 35.1 bits (77), Expect = 0.019 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +G+I V TD ++GRS+G+ F+ F PE+ K I+ ++ + Sbjct: 30 FGDIVEAVVITDKSSGRSKGYGFVTFCDPEAAQKACVDPAPVIDGRRAN 78 Score = 31.1 bits (67), Expect = 0.31 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E +RN+F +FG Sbjct: 8 KVFVGGLAWETHKVSLRNYFEQFG 31 >At1g71770.1 68414.m08295 polyadenylate-binding protein 5 (PABP5) identical to GB:Q05196 from [Arabidopsis thaliana] Length = 668 Score = 34.7 bits (76), Expect = 0.025 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 8/77 (10%) Frame = +3 Query: 48 TGRSRGFAFIVFKAPESIDKVMAAGEHT-INNKKV-------DPKKAKARHGKIFVGGLS 203 T RS G+A++ F PE + M + + I ++ + DP + G +F+ L Sbjct: 81 THRSLGYAYVNFANPEDASRAMESLNYAPIRDRPIRIMLSNRDPSTRLSGKGNVFIKNLD 140 Query: 204 SEISDDEIRNFFSEFGT 254 + I + + FS FGT Sbjct: 141 ASIDNKALYETFSSFGT 157 Score = 30.3 bits (65), Expect = 0.54 Identities = 27/106 (25%), Positives = 51/106 (48%), Gaps = 24/106 (22%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPE----SIDKV--MAAGEHTI----NNKKVDP 155 YG+I S V D +G SR F F+ F +PE +++K+ ++ GE + KK D Sbjct: 248 YGDISSAVVMKD-QSGNSRSFGFVNFVSPEAAAVAVEKMNGISLGEDVLYVGRAQKKSDR 306 Query: 156 KK--------------AKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 ++ K + +++ L ++D++++ FSE+G Sbjct: 307 EEELRRKFEQERISRFEKLQGSNLYLKNLDDSVNDEKLKEMFSEYG 352 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPE 95 YG + S V + + G SRGF F+ + PE Sbjct: 351 YGNVTSCKVMMN-SQGLSRGFGFVAYSNPE 379 >At1g11650.2 68414.m01337 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 405 Score = 34.7 bits (76), Expect = 0.025 Identities = 11/23 (47%), Positives = 19/23 (82%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFG 251 +FVGGL + ++DD ++N FS++G Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYG 285 >At1g11650.1 68414.m01336 RNA-binding protein 45 (RBP45), putative similar to gb|U90212 DNA binding protein ACBF from Nicotiana tabacum and contains 3 PF|00076 RNA recognition motif domains. ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, gb|F1 Length = 306 Score = 34.7 bits (76), Expect = 0.025 Identities = 11/23 (47%), Positives = 19/23 (82%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFG 251 +FVGGL + ++DD ++N FS++G Sbjct: 263 VFVGGLDASVTDDHLKNVFSQYG 285 >At3g16380.1 68416.m02074 polyadenylate-binding protein, putative / PABP, putative similar to polyadenylate-binding protein (poly(A)-binding protein) from {Arabidopsis thaliana} SP|P42731, [Cucumis sativus] GI:7528270, {Homo sapiens} SP|Q13310, {Arabidopsis thaliana} SP|Q05196; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 537 Score = 34.3 bits (75), Expect = 0.033 Identities = 17/36 (47%), Positives = 21/36 (58%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 YG + S+ V D GRSRGF F+ F PE+ K M Sbjct: 225 YGTVSSVVVMRD-GMGRSRGFGFVNFCNPENAKKAM 259 Score = 29.1 bits (62), Expect = 1.3 Identities = 21/89 (23%), Positives = 39/89 (43%), Gaps = 12/89 (13%) Frame = +3 Query: 24 INVKTDPNTGRSRGFAFIVFKAPESIDKVMAA-------GEHTINNKKVDPKKAKARHGK 182 ++ K G+S+GF F+ F +S +A G+ K ++ + A G Sbjct: 139 LSCKVVEENGQSKGFGFVQFDTEQSAVSARSALHGSMVYGKKLFVAKFINKDERAAMAGN 198 Query: 183 -----IFVGGLSSEISDDEIRNFFSEFGT 254 ++V L ++DD + FS++GT Sbjct: 199 QDSTNVYVKNLIETVTDDCLHTLFSQYGT 227 Score = 27.5 bits (58), Expect = 3.8 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVF 83 YG+I S V N GRS+GF F+ F Sbjct: 327 YGQIVSAKVMCHEN-GRSKGFGFVCF 351 >At3g52150.1 68416.m05724 RNA recognition motif (RRM)-containing protein similar to chloroplast RNA-binding protein cp33 [Arabidopsis thaliana] GI:681912; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) domain Length = 253 Score = 33.9 bits (74), Expect = 0.044 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 1/53 (1%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESID-KVMAAGEHTINNKKVDPKKA 164 G++ S V P T +S GF F+ F + E ++ ++A + +K+ KA Sbjct: 201 GKVVSAKVSRVPGTSKSTGFGFVTFSSEEDVEAAIVALNNSLLEGQKIRVNKA 253 Score = 30.3 bits (65), Expect = 0.54 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 +G +E + V D +GRSR F F K+ E + V+ Sbjct: 99 HGAVEKVQVMYDKYSGRSRRFGFATMKSVEDANAVV 134 >At2g44710.1 68415.m05564 RNA recognition motif (RRM)-containing protein Length = 809 Score = 33.9 bits (74), Expect = 0.044 Identities = 18/81 (22%), Positives = 36/81 (44%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIF 188 GE+ + + +P T +S+G AF+ F E + + + + N K A + +F Sbjct: 238 GEVTEVRILKNPQTKKSKGSAFLRFATVEQAKRAVKELKSPMINGKKCGVTASQDNDTLF 297 Query: 189 VGGLSSEISDDEIRNFFSEFG 251 VG + + + +R +G Sbjct: 298 VGNICKIWTPEALREKLKHYG 318 >At2g37510.1 68415.m04600 RNA-binding protein, putative similar to SP|P10979 Glycine-rich RNA-binding, abscisic acid-inducible protein {Zea mays}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 142 Score = 33.9 bits (74), Expect = 0.044 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 116 ++G++ V TD ++GRS+GF F+ + E +K A Sbjct: 56 SFGQLVDARVITDRDSGRSKGFGFVTYATIEDAEKAKA 93 >At2g24350.1 68415.m02910 RNA recognition motif (RRM)-containing protein low similarity to poly(A) binding protein II from [Xenopus laevis] GI:11527140, [Mus musculus] GI:2351846, [Bos taurus] GI:1051125; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 537 Score = 33.9 bits (74), Expect = 0.044 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 116 G ++++ V TDP T +G AF+ F ES+ K +A Sbjct: 469 GAVQNVIVVTDPVTRHPKGTAFVTFATKESVGKAVA 504 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 33.9 bits (74), Expect = 0.044 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 ++G + N+ D TG S+G+AF V++ P D AA Sbjct: 397 SFGPLRGFNLVKDRETGNSKGYAFCVYQDPSVTDIACAA 435 >At5g04280.1 68418.m00421 glycine-rich RNA-binding protein Length = 310 Score = 33.5 bits (73), Expect = 0.058 Identities = 15/29 (51%), Positives = 21/29 (72%), Gaps = 1/29 (3%) Frame = +3 Query: 168 ARHG-KIFVGGLSSEISDDEIRNFFSEFG 251 A+ G +IFVGGLS E++D ++ FS FG Sbjct: 3 AKEGSRIFVGGLSPEVTDRDLERAFSRFG 31 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 6/57 (10%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA------GEHTINNKKVDPK 158 +G+I + + +TGRSRGF FI F ++D+ + G+ I+ + +PK Sbjct: 30 FGDILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 Score = 31.5 bits (68), Expect = 0.24 Identities = 14/55 (25%), Positives = 30/55 (54%), Gaps = 1/55 (1%) Frame = +2 Query: 251 NFLEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPK 412 + L+ ++ ++ + +GF FITF + +++ ++ R G + + V RA PK Sbjct: 32 DILDCQIMLERDTGRSRGFGFITFADRRAMDESIREMHGRDFGDRVISVNRAEPK 86 >At3g56860.3 68416.m06325 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 33.5 bits (73), Expect = 0.058 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 275 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 415 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 33.5 bits (73), Expect = 0.058 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 268 FGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 31.5 bits (68), Expect = 0.24 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKA 89 YGEIE D +G+S+G+ FI++K+ Sbjct: 163 YGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.2 68416.m06324 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 33.5 bits (73), Expect = 0.058 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 275 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 415 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 33.5 bits (73), Expect = 0.058 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 268 FGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 31.5 bits (68), Expect = 0.24 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKA 89 YGEIE D +G+S+G+ FI++K+ Sbjct: 163 YGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g56860.1 68416.m06323 UBP1 interacting protein 2a (UBA2a) identical to UBP1 interacting protein 2a [Arabidopsis thaliana] GI:19682816; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 478 Score = 33.5 bits (73), Expect = 0.058 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +2 Query: 275 FDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 415 FDK + KG+ FI ++S + LK P++ IG + + A+ P Sbjct: 173 FDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLASKGP 219 Score = 33.5 bits (73), Expect = 0.058 Identities = 17/53 (32%), Positives = 26/53 (49%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKA 164 +GEIE + D TGR +GF V+K+ ES + + T + +KA Sbjct: 268 FGEIEEGPLGLDKYTGRPKGFCLFVYKSSESAKRALEEPHKTFEGHILHCQKA 320 Score = 31.5 bits (68), Expect = 0.24 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKA 89 YGEIE D +G+S+G+ FI++K+ Sbjct: 163 YGEIEDCKAVFDKISGKSKGYGFILYKS 190 >At3g52380.1 68416.m05757 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to chloroplast RNA-binding protein (cp33) GB:BAA06523 (Arabidopsis thaliana) (Plant Mol. Biol. 27 (3), 529-539 (1995)); contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 33.5 bits (73), Expect = 0.058 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = +3 Query: 45 NTGRSRGFAFIVFKAPESIDKVMA 116 NTGRSRGF FI F++ E++ +A Sbjct: 255 NTGRSRGFGFISFESAENVQSALA 278 Score = 28.7 bits (61), Expect = 1.7 Identities = 18/75 (24%), Positives = 34/75 (45%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIF 188 G + + + D T RSRGF F+ + E + M N+ ++ + K ++ Sbjct: 140 GTVVDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAM----QMFNSSQIGGRTVKVNFPEVP 195 Query: 189 VGGLSSEISDDEIRN 233 GG +E+ +IR+ Sbjct: 196 RGG-ENEVMRTKIRD 209 Score = 27.5 bits (58), Expect = 3.8 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDV 394 ++V++ +DK ++ +GF F+T S E+ + IGG+ V V Sbjct: 143 VDVQIVYDKVTDRSRGFGFVTMGSIEEAKEAMQMFNSSQIGGRTVKV 189 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 33.1 bits (72), Expect = 0.077 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVF 83 A+G +E + + DP TG+ +GF FI F Sbjct: 287 AFGPVELVQLPLDPETGQCKGFGFIQF 313 >At4g39260.3 68417.m05559 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 92 Score = 33.1 bits (72), Expect = 0.077 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 29 FGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 391 D+ + +GF F+TF+ E+ + D ++ + GKE+D Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.2 68417.m05558 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 126 Score = 33.1 bits (72), Expect = 0.077 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 29 FGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 391 D+ + +GF F+TF+ E+ + D ++ + GKE+D Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At4g39260.1 68417.m05557 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 169 Score = 33.1 bits (72), Expect = 0.077 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +G++ + D +GRSRGF F+ FK +K M +N K++D Sbjct: 29 FGDVIDSKIINDRESGRSRGFGFVTFKD----EKAMRDAIEEMNGKELD 73 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/38 (31%), Positives = 23/38 (60%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 391 D+ + +GF F+TF+ E+ + D ++ + GKE+D Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIE----EMNGKELD 73 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 >At2g16260.1 68415.m01862 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Daucus carota} SP|Q03878, {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 185 Score = 33.1 bits (72), Expect = 0.077 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESI 101 +GE+ + D TGRS+GF F+ FK +S+ Sbjct: 67 FGEVFDSKIIIDRETGRSKGFRFVTFKDEDSM 98 Score = 27.5 bits (58), Expect = 3.8 Identities = 14/43 (32%), Positives = 24/43 (55%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVDVKRAT 406 D+ + KGF F+TF+ E D ++T + G+E+D + T Sbjct: 78 DRETGRSKGFRFVTFKDE----DSMRTAIDRMNGQELDGRNIT 116 >At1g60650.2 68414.m06828 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.1 bits (72), Expect = 0.077 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKARHG 179 YG+I + +TGR RGF FI F D + + NK + KA+ + G Sbjct: 35 YGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVG 93 Score = 31.1 bits (67), Expect = 0.31 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPK 412 E ++ + + +GF FITF + +D +K R +G K + V +A PK Sbjct: 40 ECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 +IFVGGLS ++++ ++ + F +G Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYG 36 >At1g60650.1 68414.m06827 glycine-rich RNA-binding protein, putative similar to RNA binding protein(RZ-1) GI:1435061 from [Nicotiana sylvestris]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 292 Score = 33.1 bits (72), Expect = 0.077 Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVMAAGEHTINNKKVDPKKAKARHG 179 YG+I + +TGR RGF FI F D + + NK + KA+ + G Sbjct: 35 YGKITECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPKVG 93 Score = 31.1 bits (67), Expect = 0.31 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLK-TPKRTIGGKEVDVKRATPK 412 E ++ + + +GF FITF + +D +K R +G K + V +A PK Sbjct: 40 ECQIMVGRDTGRPRGFGFITFTDRRGADDAIKHMHGRELGNKVISVNKAEPK 91 Score = 27.1 bits (57), Expect = 5.1 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 +IFVGGLS ++++ ++ + F +G Sbjct: 13 RIFVGGLSWDVTERQLESTFDRYG 36 >At1g49600.1 68414.m05561 RNA-binding protein 47 (RBP47), putative similar to DNA binding protein ACBF GB:U90212 GI:1899187 from [Nicotiana tabacum] Length = 445 Score = 33.1 bits (72), Expect = 0.077 Identities = 17/56 (30%), Positives = 31/56 (55%) Frame = +3 Query: 117 AGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTK 284 AG H N D ++ + IFVGGL ++++++++ FS+FG + P+ K Sbjct: 310 AGGHGGNGSMSD---GESNNSTIFVGGLDADVTEEDLMQPFSDFGEVVSVKIPVGK 362 Score = 29.5 bits (63), Expect = 0.95 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVF 83 Y ++ V D NTGRS+G+ F+ F Sbjct: 237 YPSVKGAKVVIDSNTGRSKGYGFVRF 262 >At5g04810.1 68418.m00503 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile: PF01535 PPR repeat Length = 952 Score = 32.3 bits (70), Expect = 0.14 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = +3 Query: 150 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 +P++ + GKIFVG L + I E FF +FG Sbjct: 156 NPQQEFRQEGKIFVGNLPTWIKKPEFEEFFRQFG 189 >At4g16280.3 68417.m02471 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 533 Score = 32.3 bits (70), Expect = 0.14 Identities = 19/93 (20%), Positives = 42/93 (45%), Gaps = 11/93 (11%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKVDPK 158 +G + + + D TG+ +G F+ + + D+ + A G + + D + Sbjct: 143 HGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYADGE 202 Query: 159 KAK--ARHGKIFVGGLSSEISDDEIRNFFSEFG 251 + + K+FVG L+ + ++ E+ F +FG Sbjct: 203 RERIGTLEFKLFVGSLNKQATEKEVEEIFLQFG 235 >At4g16280.2 68417.m02470 flowering time control protein / FCA gamma (FCA) identical to SP|O04425 Flowering time control protein FCA {Arabidopsis thaliana}; four alternative splice variants, one splicing isoform contains a non-consensus CA donor splice site, based on cDNA: gi:2204090 Length = 747 Score = 32.3 bits (70), Expect = 0.14 Identities = 19/93 (20%), Positives = 42/93 (45%), Gaps = 11/93 (11%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA---------GEHTINNKKVDPK 158 +G + + + D TG+ +G F+ + + D+ + A G + + D + Sbjct: 143 HGNVLEVALIKDKRTGQQQGCCFVKYATSKDADRAIRALHNQITLPGGTGPVQVRYADGE 202 Query: 159 KAK--ARHGKIFVGGLSSEISDDEIRNFFSEFG 251 + + K+FVG L+ + ++ E+ F +FG Sbjct: 203 RERIGTLEFKLFVGSLNKQATEKEVEEIFLQFG 235 >At3g18610.1 68416.m02365 nucleolin, putative contains Pfam profile: PF00076 RNA recognition motif Length = 636 Score = 32.3 bits (70), Expect = 0.14 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFI 77 GE+ ++V TD TG SRGFA+I Sbjct: 507 GEVTRVHVPTDRETGASRGFAYI 529 Score = 29.9 bits (64), Expect = 0.72 Identities = 15/56 (26%), Positives = 24/56 (42%) Frame = +3 Query: 84 KAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 K ++ V A + K + + +F G LS +I+ +I NFF E G Sbjct: 353 KKDSDVEMVDAEQKSNAKQPKTPTNQTQGGSKTLFAGNLSYQIARSDIENFFKEAG 408 >At3g08000.1 68416.m00977 RNA-binding protein, putative similar to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925; contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 143 Score = 32.3 bits (70), Expect = 0.14 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVF 83 ++GE+ + + D +GRSRGF F+ F Sbjct: 63 SFGEVAEVRIAYDKGSGRSRGFGFVDF 89 Score = 29.5 bits (63), Expect = 0.95 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+F+GGLS + + +++ FS FG Sbjct: 42 KLFIGGLSWSVDEQSLKDAFSSFG 65 >At1g03457.2 68414.m00327 RNA-binding protein, putative similar to Etr-1 [Danio rerio] GI:7670536, BRUNO-like 6 RNA-binding protein [Homo sapiens] GI:15341327; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 438 Score = 32.3 bits (70), Expect = 0.14 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 21/101 (20%) Frame = +3 Query: 15 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV-----DPKKAKARHG 179 + +N+ + T RG F+ E DKV+ ++ +NKK P + K G Sbjct: 38 VNEVNIIKEKTTRAPRGCCFLTCPTREDADKVI----NSFHNKKTLPGASSPLQVKYADG 93 Query: 180 ----------------KIFVGGLSSEISDDEIRNFFSEFGT 254 K+FVG L +S+ E+++ FSE+GT Sbjct: 94 ELERLDVLDCSCNPEHKLFVGMLPKNVSETEVQSLFSEYGT 134 >At2g18510.1 68415.m02157 pre-mRNA splicing factor, putative similar to SP|Q15427 Splicing factor 3B subunit 4 (Spliceosome associated protein 49) (SAP 49) (SF3b50) (Pre-mRNA splicing factor SF3b 49 kDa subunit) {Homo sapiens}; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 363 Score = 31.9 bits (69), Expect = 0.18 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 3/50 (6%) Frame = +3 Query: 3 AYGEIESI-NVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTINNK 143 A+G I S + DP+TG SRGF FI + + E+ D + + G++ N + Sbjct: 134 AFGVIASNPKIMRDPDTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQ 183 Score = 30.7 bits (66), Expect = 0.41 Identities = 22/88 (25%), Positives = 40/88 (45%), Gaps = 7/88 (7%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESID---KVMAA----GEHTINNKKVDPKKAK 167 G + ++ V D T + + FI +++ E D KV+ G+ NK KK+ Sbjct: 49 GPVVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAIKVLNMIKLHGKPIRVNKASQDKKSL 108 Query: 168 ARHGKIFVGGLSSEISDDEIRNFFSEFG 251 +F+G L ++ + + + FS FG Sbjct: 109 DVGANLFIGNLDPDVDEKLLYDTFSAFG 136 >At1g22910.3 68414.m02863 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 347 Score = 31.9 bits (69), Expect = 0.18 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 36 FGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E + ++ F +FG Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFG 37 >At1g22910.2 68414.m02861 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 242 Score = 31.9 bits (69), Expect = 0.18 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 36 FGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E + ++ F +FG Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFG 37 >At1g22910.1 68414.m02862 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM); similar to GB:AAC33496 Length = 249 Score = 31.9 bits (69), Expect = 0.18 Identities = 14/49 (28%), Positives = 25/49 (51%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 +GEI V TD +GRS+G+ F+ F+ E+ I+ ++ + Sbjct: 36 FGEILEAVVITDKASGRSKGYGFVTFREAEAARSACVDATPVIDGRRAN 84 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+FVGGL+ E + ++ F +FG Sbjct: 14 KVFVGGLAWETHKETMKKHFEQFG 37 >At1g01080.1 68414.m00010 33 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp33, putative similar to 33 KDA RIBONUCLEOPROTEIN GB:P19684 from [Nicotiana sylvestris] Length = 293 Score = 31.9 bits (69), Expect = 0.18 Identities = 32/108 (29%), Positives = 47/108 (43%), Gaps = 25/108 (23%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFK-------APESIDKVMAAGEH------------ 128 +G + S+ V +P TG SRG ++ A S+D G Sbjct: 131 FGTVISVEVSRNPQTGESRGSGYVTMGSINSAKIAIASLDGTEVGGREMRVRYSVDMNPG 190 Query: 129 TINNKKV---DPKKA---KARHGKIFVGGLSSEISDDEIRNFFSEFGT 254 T N +V PKK +++H K++VG L D +RN FS+FGT Sbjct: 191 TRRNPEVLNSTPKKILMYESQH-KVYVGNLPWFTQPDGLRNHFSKFGT 237 Score = 30.7 bits (66), Expect = 0.41 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 116 +G I S V D TGR+R FAF+ F + E D ++ Sbjct: 235 FGTIVSTRVLHDRKTGRNRVFAFLSFTSGEERDAALS 271 >At5g50250.1 68418.m06223 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (1/2/3) (AtRBP33) (cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 289 Score = 31.5 bits (68), Expect = 0.24 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 +G++ V +D TGRSRGF F+ ++ +AA Sbjct: 230 HGKVVDARVVSDRETGRSRGFGFVQMSNENEVNVAIAA 267 Score = 30.7 bits (66), Expect = 0.41 Identities = 23/95 (24%), Positives = 39/95 (41%), Gaps = 14/95 (14%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKARHG-- 179 G +E V + +T +SRGF F+ E +K V +N +++ +A R Sbjct: 137 GTVEISEVIYNRDTDQSRGFGFVTMSTVEEAEKAVEKFNSFEVNGRRLTVNRAAPRGSRP 196 Query: 180 -----------KIFVGGLSSEISDDEIRNFFSEFG 251 +I+VG L ++ + FSE G Sbjct: 197 ERQPRVYDAAFRIYVGNLPWDVDSGRLERLFSEHG 231 >At4g34110.1 68417.m04839 polyadenylate-binding protein 2 (PABP2) non-consensus TA donor splice site at exon 2, polyadenylate-binding protein - Triticum aestivum (common wheat),PIR:T06979 Length = 443 Score = 31.5 bits (68), Expect = 0.24 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 116 +G + S V DPN G S+G F+ F PE + M+ Sbjct: 155 FGTVTSSKVMRDPN-GTSKGSGFVAFATPEEATEAMS 190 Score = 29.1 bits (62), Expect = 1.3 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = +3 Query: 102 DKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 DK + G + ++ D K + ++V L+ +DD+++N F E+G Sbjct: 5 DKQVYVGPF-LRRQERDSTANKTKFTNVYVKNLAESTTDDDLKNAFGEYG 53 Score = 28.3 bits (60), Expect = 2.2 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +3 Query: 165 KARHGKIFVGGLSSEISDDEIRNFFSEFGT 254 K + ++V L ISD++++ FS FGT Sbjct: 128 KFQSSNLYVKNLDPSISDEKLKEIFSPFGT 157 >At3g54230.1 68416.m05994 zinc finger protein-related / D111/G-patch domain-containing protein / RNA recognition motif (RRM)-containing protein KIAA0122 gene , Homo sapiens, EMBL:HSDKG02; contains Pfam profiles PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain), PF01585: G-patch domain, weak hit to PF00641: Zn-finger in Ran binding protein and others Length = 1105 Score = 31.5 bits (68), Expect = 0.24 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEH 128 +G + + V + N+G SRGFAFI F ++ +M EH Sbjct: 321 WGPLHHVRVIREQNSGISRGFAFIDFPTVDAARTMMDRIEH 361 Score = 30.3 bits (65), Expect = 0.54 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI---NNKKVDPKKAKARH 176 + I+ + + D T SRGFAF+ F + E K + A T N K + AK+ H Sbjct: 481 HAPIKDLRLVRDKFTHVSRGFAFVHFYSVEDATKALEATNRTALERNGKILRVAYAKSVH 540 Query: 177 G 179 G Sbjct: 541 G 541 >At5g46840.1 68418.m05771 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 501 Score = 31.1 bits (67), Expect = 0.31 Identities = 13/51 (25%), Positives = 28/51 (54%) Frame = +3 Query: 15 IESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAK 167 IE++ V DP+ +G A+++FK E+ + V+ G + +++ + K Sbjct: 313 IEAVRVIRDPHLNIGKGIAYVLFKTREAANLVLKKGYLKLRERELRISRVK 363 >At4g24770.1 68417.m03546 31 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein RNP-T, putative / RNA-binding protein 1/2/3, putative / RNA-binding protein cp31, putative similar to SP|Q04836 31 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein RNP-T) (RNA-binding protein 1/2/3) (AtRBP33) (RNA-binding protein cp31) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 329 Score = 31.1 bits (67), Expect = 0.31 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 +G++ V D TGRSRGF F+ + +++ ++A Sbjct: 267 HGKVVEARVVYDRETGRSRGFGFVTMSDVDELNEAISA 304 Score = 27.9 bits (59), Expect = 2.9 Identities = 22/95 (23%), Positives = 39/95 (41%), Gaps = 14/95 (14%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKA-PESIDKVMAAGEHTINNKKVDPKKAKARHG-- 179 G +E V + T +SRGF F+ + E+ V + +N + + KA R Sbjct: 174 GTVEIAEVIYNRETDQSRGFGFVTMSSVDEAETAVEKFNRYDLNGRLLTVNKAAPRGSRP 233 Query: 180 -----------KIFVGGLSSEISDDEIRNFFSEFG 251 +++VG L ++ + + FSE G Sbjct: 234 ERAPRVYEPAFRVYVGNLPWDVDNGRLEQLFSEHG 268 >At4g24270.2 68417.m03484 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 817 Score = 31.1 bits (67), Expect = 0.31 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 182 G ++SI + +TG+ RG A+ F E + +A KK+ ++ + GK Sbjct: 675 GGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKKGK 732 >At4g24270.1 68417.m03483 RNA recognition motif (RRM)-containing protein low similarity to tumor-rejection antigen SART3 [Mus musculus] GI:7637845; contains INTERPRO:IPR000504 RNA-binding region RNP-1 (RNA recognition motif) domain Length = 816 Score = 31.1 bits (67), Expect = 0.31 Identities = 15/58 (25%), Positives = 27/58 (46%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGK 182 G ++SI + +TG+ RG A+ F E + +A KK+ ++ + GK Sbjct: 675 GGVDSIRILHHKDTGKPRGLAYADFVDDEHLAAAIAKNRKMFFGKKISIARSNPKKGK 732 >At1g07350.2 68414.m00784 transformer serine/arginine-rich ribonucleoprotein, putative similar to GB:Y09506 from [Nicotiana tabacum] (Plant Mol. Biol. 35 (3), 261-269 (1997)) Length = 129 Score = 31.1 bits (67), Expect = 0.31 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 149 G++ +++ DP T SRGF FI K+ ++ + + +H++ +V Sbjct: 69 GKVTDVHLVLDPWTRESRGFGFISMKSVGDANRCIRSLDHSVLQGRV 115 >At5g04600.1 68418.m00460 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 222 Score = 30.7 bits (66), Expect = 0.41 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 8/62 (12%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAG--------EHTINNKKVDPKK 161 +G ++ + V + TG+S+ F FI F+ PE + +AAG EH + ++P+ Sbjct: 83 FGTVKRVRVARNKKTGKSKHFGFIQFEDPEVAE--IAAGAMNDYLLMEHMLKVHVIEPEN 140 Query: 162 AK 167 K Sbjct: 141 VK 142 Score = 26.2 bits (55), Expect = 8.9 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFGTS*KWRCPLTKQRTKER 302 +++G + + EI FFS+FGT + R K+ K + Sbjct: 62 LYIGRIPHGFYETEIEAFFSQFGTVKRVRVARNKKTGKSK 101 >At4g39260.4 68417.m05560 glycine-rich RNA-binding protein 8 (GRP8) (CCR1) SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) (GRP8) {Arabidopsis thaliana} isoform contains a non-consensus CG acceptor splice site at intron 2 Length = 105 Score = 30.7 bits (66), Expect = 0.41 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFK 86 +G++ + D +GRSRGF F+ FK Sbjct: 29 FGDVIDSKIINDRESGRSRGFGFVTFK 55 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/24 (41%), Positives = 18/24 (75%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 + FVGGL+ +D++++ FS+FG Sbjct: 7 RCFVGGLAWATNDEDLQRTFSQFG 30 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGG 379 D+ + +GF F+TF+ E+ + D ++ + GG Sbjct: 40 DRESGRSRGFGFVTFKDEKAMRDAIEEMNGSGGG 73 >At3g53460.2 68416.m05901 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 334 Score = 30.7 bits (66), Expect = 0.41 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESID 104 G +E + V D TGRSRGF F+ ++ Sbjct: 123 GNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 30.3 bits (65), Expect = 0.54 Identities = 13/56 (23%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 173 G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 273 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 328 Score = 30.3 bits (65), Expect = 0.54 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 415 +E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 276 VEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 329 >At3g53460.1 68416.m05900 29 kDa ribonucleoprotein, chloroplast / RNA-binding protein cp 29 nearly identical to SP|Q43349 29 kDa ribonucleoprotein, chloroplast precursor (RNA-binding protein cp29) {Arabidopsis thaliana} Length = 342 Score = 30.7 bits (66), Expect = 0.41 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESID 104 G +E + V D TGRSRGF F+ ++ Sbjct: 123 GNVEMVEVIYDKVTGRSRGFGFVTMSTAAEVE 154 Score = 30.3 bits (65), Expect = 0.54 Identities = 13/56 (23%), Positives = 31/56 (55%), Gaps = 1/56 (1%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 173 G++ V D ++GRS+GF F+ + + + K + + ++ +++ +A+AR Sbjct: 281 GKVVEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEAR 336 Score = 30.3 bits (65), Expect = 0.54 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRATPKP 415 +E + +D+ + KGF F+T S Q V + + + G+++ V A +P Sbjct: 284 VEARVIYDRDSGRSKGFGFVTLSSSQEVQKAINSLNGADLDGRQIRVSEAEARP 337 >At4g13850.2 68417.m02146 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 153 Score = 30.3 bits (65), Expect = 0.54 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVF 83 +G++ V D TGRSRGF F+ F Sbjct: 58 FGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+F+GGLS D +R+ F+ FG Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFG 59 >At4g13850.1 68417.m02145 glycine-rich RNA-binding protein (GRP2) glycine-rich RNA binding protein 2 AtGRP2 [Arabidopsis thaliana] GI:2826811 Length = 158 Score = 30.3 bits (65), Expect = 0.54 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVF 83 +G++ V D TGRSRGF F+ F Sbjct: 58 FGDVVDAKVIVDRETGRSRGFGFVNF 83 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 K+F+GGLS D +R+ F+ FG Sbjct: 36 KLFIGGLSWGTDDASLRDAFAHFG 59 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 30.3 bits (65), Expect = 0.54 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFGTS*KWRCPL 278 K++VGG+ + ++DEIR++F G K C + Sbjct: 162 KLYVGGIPYQSTEDEIRSYFRSCGVIIKVDCKM 194 >At3g54770.1 68416.m06060 RNA recognition motif (RRM)-containing protein low similarity to RRM-containing protein SEB-4 [Xenopus laevis] GI:8895698; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 29.9 bits (64), Expect = 0.72 Identities = 13/49 (26%), Positives = 25/49 (51%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 YG+I + +D T RS+G+ F+ FK ++ + IN ++ + Sbjct: 40 YGDILEAVIISDKLTRRSKGYGFVTFKDAKAATRACEDSTPIINGRRAN 88 >At2g27330.1 68415.m03286 RNA recognition motif (RRM)-containing protein Length = 116 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/36 (30%), Positives = 21/36 (58%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 YG++ ++V D R +GFA++ F + E +K + Sbjct: 44 YGQVLKVDVIMDKIRCRPKGFAYVTFSSKEEAEKAL 79 Score = 29.9 bits (64), Expect = 0.72 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEV 388 L+V++ DK + + KGF ++TF S E+ LL+ + + G+ V Sbjct: 48 LKVDVIMDKIRCRPKGFAYVTFSSKEEAEKALLELNAQLVDGRVV 92 >At1g72800.1 68414.m08416 nuM1-related contains similarity with nuM1 GI:1279563 from [Medicago sativa] Length = 335 Score = 29.9 bits (64), Expect = 0.72 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 134 ++GEI + V TG S G+A+I K E +K + G H + Sbjct: 260 SFGEITRVFVPPSHGTGGSLGYAYIDLK--EGAEKALELGRHDV 301 >At1g60000.1 68414.m06759 29 kDa ribonucleoprotein, chloroplast, putative / RNA-binding protein cp29, putative similar to 29 kDa ribonucleoprotein chloroplast precursor {Nicotiana sylvestris} SP|Q08935, SP|Q08937; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) contains an AG-donor site at intron. Length = 258 Score = 29.9 bits (64), Expect = 0.72 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 12/90 (13%) Frame = +3 Query: 18 ESINVKTDPNTGRSRGFAFIVFKAPE-------SIDKVMAAGEHTINNKKVDPKKAK--- 167 E + V + +TG+SRGFAF+ E ++D G N PK K Sbjct: 112 ELVEVLYNRDTGQSRGFAFVTMSNVEDCNIIIDNLDGTEYLGRALKVNFADKPKPNKEPL 171 Query: 168 --ARHGKIFVGGLSSEISDDEIRNFFSEFG 251 K+FVG LS ++ + + F E G Sbjct: 172 YPETEHKLFVGNLSWTVTSESLAGAFRECG 201 Score = 28.7 bits (61), Expect = 1.7 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 G++ V D +TGRSRG+ F+ + + ++ + Sbjct: 201 GDVVGARVVFDGDTGRSRGYGFVCYSSKAEMETAL 235 >At1g51510.1 68414.m05797 RNA-binding protein, putative similar to RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9 from [Homo sapiens], RNA-binding protein Y14 [Xenopus laevis] GI:11034807; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 202 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/38 (28%), Positives = 23/38 (60%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 +GEI+++N+ D +G +G+A I ++ E ++A Sbjct: 118 FGEIKNLNLNLDRRSGYVKGYALIEYEKKEEAQSAISA 155 >At1g48920.1 68414.m05480 nucleolin, putative similar to nuM1 protein GI:1279562 from [Medicago sativa] Length = 557 Score = 29.9 bits (64), Expect = 0.72 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVF 83 GEI++++V D +TG S+G A++ F Sbjct: 429 GEIKNVSVPIDRDTGNSKGIAYLEF 453 Score = 26.2 bits (55), Expect = 8.9 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFGTS 257 KIFV G + +S+D+I+N E +S Sbjct: 402 KIFVKGFDASLSEDDIKNTLREHFSS 427 >At5g47320.1 68418.m05833 30S ribosomal protein S19, mitochondrial (RPS19) Length = 212 Score = 29.5 bits (63), Expect = 0.95 Identities = 12/39 (30%), Positives = 23/39 (58%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 ++ + V T+ TGRSRG+ F+ F + +S + ++A Sbjct: 53 SFNGVTEARVMTNKVTGRSRGYGFVNFISEDSANSAISA 91 >At4g27000.1 68417.m03884 RNA-binding protein 45 (RBP45), putative DNA binding protein ACBF - Nicotiana tabacum, PID:g1899188 Length = 415 Score = 29.5 bits (63), Expect = 0.95 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 24/106 (22%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA--GEHTIN---------NKK-- 146 Y ++ V D TGRS+G+ F+ F + M G++ + NKK Sbjct: 197 YSSVKGAKVVNDRTTGRSKGYGFVRFADESEQIRAMTEMNGQYCSSRPMRTGPAANKKPL 256 Query: 147 -VDPKKAKARHGK----------IFVGGLSSEISDDEIRNFFSEFG 251 + P + G IFVG + +++D++++ F +FG Sbjct: 257 TMQPASYQNTQGNSGESDPTNTTIFVGAVDQSVTEDDLKSVFGQFG 302 >At3g12640.1 68416.m01573 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 674 Score = 29.5 bits (63), Expect = 0.95 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 116 +GE+ + TDP TG+ G A+I F E+ + ++ Sbjct: 539 FGEVLKAFIVTDPATGQPSGSAYIEFTRKEAAENALS 575 >At3g06970.1 68416.m00828 RNA recognition motif (RRM)-containing protein contains Pfam profile: PF00076 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 272 Score = 29.5 bits (63), Expect = 0.95 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 KIFVG L+ + D++R +F +FG Sbjct: 13 KIFVGNLTWRTTADDLRRYFEQFG 36 >At1g73530.1 68414.m08511 RNA recognition motif (RRM)-containing protein low similarity to SP|Q03251 Glycine-rich RNA-binding protein 8 (CCR1 protein) {Arabidopsis thaliana}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 181 Score = 29.5 bits (63), Expect = 0.95 Identities = 15/63 (23%), Positives = 29/63 (46%) Frame = +3 Query: 63 GFAFIVFKAPESIDKVMAAGEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFS 242 G I + I V+ + + ++ P + K++V GLS ++D +R+ F Sbjct: 39 GTGVISARRRRDIGGVLISSCLSTDSSSSPPSSSSGPKTKLYVSGLSFRTTEDTLRDTFE 98 Query: 243 EFG 251 +FG Sbjct: 99 QFG 101 >At1g60200.1 68414.m06781 splicing factor PWI domain-containing protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF01480: PWI domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 899 Score = 29.5 bits (63), Expect = 0.95 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 3/46 (6%) Frame = +2 Query: 278 DKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKE--VDVKRAT 406 D T + KGF F FES E ++ + +RTI G+E V+V +AT Sbjct: 237 DPTTKKPKGFGFYEFESAEGILRAIRLLTQRTIDGQELLVNVNQAT 282 Score = 26.2 bits (55), Expect = 8.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESI 101 G ++S DP T + +GF F F++ E I Sbjct: 227 GHVKSCLRAEDPTTKKPKGFGFYEFESAEGI 257 >At1g54080.1 68414.m06162 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 426 Score = 29.5 bits (63), Expect = 0.95 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFK 86 A+ V D TGRSRGF F+ F+ Sbjct: 170 AFNSCSDARVMWDQKTGRSRGFGFVSFR 197 >At1g18630.1 68414.m02322 glycine-rich RNA-binding protein, putative similar to glycine-rich RNA-binding protein from {Sorghum bicolor} SP|Q99070, GI:1778373 from [Pisum sativum]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 155 Score = 29.5 bits (63), Expect = 0.95 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINNKKVD 152 ++G+I V D +G SRGF F+ + + E + M A + NK++D Sbjct: 58 SFGKIVDAVVVLDRESGLSRGFGFVTYDSIEVANNAMQA----MQNKELD 103 >At4g13860.1 68417.m02147 glycine-rich RNA-binding protein, putative similar to Glycine-rich RNA-binding protein 2, mitochondrial precursor (AtGRP2) (Swiss-Prot:Q9SVM8) [Arabidopsis thaliana] ; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 87 Score = 29.1 bits (62), Expect = 1.3 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPK 158 YG + V D T RSRGF F+ + + + ++ + +N ++V K Sbjct: 26 YGNVVDAIVMRDRYTDRSRGFGFVTYSSHSEAEAAVSGMDGKELNGRRVSVK 77 Score = 26.6 bits (56), Expect = 6.7 Identities = 10/24 (41%), Positives = 16/24 (66%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 +++VG LS +DD +R FS +G Sbjct: 4 RVYVGNLSPTTTDDMLREAFSGYG 27 >At3g11400.1 68416.m01390 eukaryotic translation initiation factor 3G / eIF3g nearly identical to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751 Length = 294 Score = 29.1 bits (62), Expect = 1.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 +G + + V D TG SRGF F+ F + E + + Sbjct: 236 FGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAI 271 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +3 Query: 120 GEHTINNKKVDPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 GE NN + + + + VG +SS + D E++ F +FG Sbjct: 198 GERGGNNSVGELNRGEIPSRTLLVGNISSNVEDYELKVLFEQFG 241 >At5g43960.2 68418.m05378 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 391 Score = 28.7 bits (61), Expect = 1.7 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 275 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 415 F +T+ G C F+ FE V + +K +GG++V ++ P P Sbjct: 289 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNP 337 >At5g43960.1 68418.m05379 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein contains Pfam profiles PF02136: Nuclear transport factor 2 (NTF2) domain, PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 450 Score = 28.7 bits (61), Expect = 1.7 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +2 Query: 275 FDKTKNQRKGFC--FITFESEQVVNDLLKTPKRTIGGKEVDVKRATPKP 415 F +T+ G C F+ FE V + +K +GG++V ++ P P Sbjct: 348 FLRTRKDVMGVCYAFVEFEDMTSVENAIKASPIYLGGRQVYIEERRPNP 396 >At3g10400.1 68416.m01246 RNA recognition motif (RRM)-containing protein low similarity to splicing factor SC35 [Arabidopsis thaliana] GI:9843653; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 261 Score = 28.7 bits (61), Expect = 1.7 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTINN 140 +G++ + V D +T +SRG AF+++ + E K + + I N Sbjct: 80 FGKVARVTVLKDRHTRQSRGVAFVLYVSREDAAKAARSMDAKILN 124 >At5g59860.1 68418.m07506 RNA recognition motif (RRM)-containing protein similar to SP|Q14011 Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 157 Score = 28.3 bits (60), Expect = 2.2 Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 278 DKTKNQRKGFCFITFESEQVVNDLLKTPK-RTIGGKEVDVKRA 403 D+ + KGF FITFESE LK + + G+ + V+ A Sbjct: 100 DQQTQRPKGFGFITFESEDDAQKALKALNGKIVNGRLIFVETA 142 >At5g06210.1 68418.m00693 RNA-binding protein, putative contains similarity to RNA-binding protein from [Nicotiana tabacum] GI:15822703, [Nicotiana sylvestris] GI:624925, [Solanum tuberosum] GI:15822705; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 146 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/56 (25%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 173 G++ + D + RS+GF F+ F + + K +M +N + + AKA+ Sbjct: 58 GQVVEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKAK 113 Score = 28.3 bits (60), Expect = 2.2 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = +2 Query: 257 LEVEMPFDKTKNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPK 412 +E ++ D+ ++ KGF F+TF S ++ L++ + + G+ + V A K Sbjct: 61 VEAQIVMDRVSDRSKGFGFVTFASADEAQKALMEFNGQQLNGRTIFVDYAKAK 113 >At4g20030.1 68417.m02932 RNA recognition motif (RRM)-containing protein low similarity to heterogeneous nuclear ribonucleoprotein G [Mus musculus] GI:5579009; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 152 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPE 95 A+GEI + + D RS+G+AFI F + + Sbjct: 62 AFGEIAEVKLIKDEAMKRSKGYAFIQFTSQD 92 >At2g21440.1 68415.m02551 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1003 Score = 28.3 bits (60), Expect = 2.2 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFK-APESIDKVMAA 119 +GE+ES+++ T R G AF+ FK A S+ + AA Sbjct: 584 FGEVESLSLVLHKVTKRPEGTAFVKFKTADASVAAISAA 622 Score = 27.1 bits (57), Expect = 5.1 Identities = 13/56 (23%), Positives = 27/56 (48%), Gaps = 1/56 (1%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESIDK-VMAAGEHTINNKKVDPKKAKAR 173 G + + T+ + RGFAF+ F E +++ + T+ +++ K+A R Sbjct: 44 GPVRRCFLVTNKGSDEHRGFAFVKFALQEDVNRAIELKNGSTVGGRRITVKQAAHR 99 >At1g17370.1 68414.m02118 oligouridylate-binding protein, putative similar to oligouridylate binding protein [Nicotiana plumbaginifolia] GI:6996560; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 419 Score = 28.3 bits (60), Expect = 2.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFK 86 Y V D TGRSRGF F+ F+ Sbjct: 162 YPTCSDARVMWDQKTGRSRGFGFVSFR 188 >At5g54580.1 68418.m06794 RNA recognition motif (RRM)-containing protein low similarity to RNA-binding protein RGP-3 [Nicotiana sylvestris] GI:1009363; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 156 Score = 27.9 bits (59), Expect = 2.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMA 116 +GE+ V TD +G S+GF F+ + E K +A Sbjct: 79 FGEVADAKVVTDRVSGYSKGFGFVRYATLEDSAKGIA 115 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 27.9 bits (59), Expect = 2.9 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAA 119 ++G ++ ++ D TG S+G+AF V++ D AA Sbjct: 381 SFGGLKGFDLVKDRETGNSKGYAFCVYQDLSVTDIACAA 419 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 27.9 bits (59), Expect = 2.9 Identities = 10/27 (37%), Positives = 19/27 (70%) Frame = +3 Query: 3 AYGEIESINVKTDPNTGRSRGFAFIVF 83 +YG I+ +++ TD T + +G+AFI + Sbjct: 160 SYGPIKRVHLVTDQLTNKPKGYAFIEY 186 >At3g46020.1 68416.m04979 RNA-binding protein, putative similar to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis}; SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 102 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/36 (30%), Positives = 19/36 (52%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 +G+I+ + D T R +GF FI F + + K + Sbjct: 30 FGQIKEARLIRDSETQRPKGFGFITFDSEDDARKAL 65 Score = 27.1 bits (57), Expect = 5.1 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +2 Query: 260 EVEMPFDKTKNQRKGFCFITFESEQVVNDLLKTPKRTIGGKEVD 391 E + D + KGF FITF+SE LK ++ GK VD Sbjct: 35 EARLIRDSETQRPKGFGFITFDSEDDARKALK----SLDGKIVD 74 >At3g14100.1 68416.m01782 oligouridylate-binding protein, putative similar to GB:CAB75429 (GI:6996560) from [Nicotiana plumbaginifolia], contains Pfam profiles: PF00076 RNA recognition motif (3 copies) Length = 427 Score = 27.9 bits (59), Expect = 2.9 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFK 86 + V D TGRSRGF F+ F+ Sbjct: 167 FSSCSDARVMWDQKTGRSRGFGFVSFR 193 >At2g14160.1 68415.m01577 RNA recognition motif (RRM)-containing protein Length = 90 Score = 27.9 bits (59), Expect = 2.9 Identities = 9/22 (40%), Positives = 17/22 (77%) Frame = +3 Query: 186 FVGGLSSEISDDEIRNFFSEFG 251 +VG L S+ +++++N FS+FG Sbjct: 11 YVGNLESDTEENDLKNAFSQFG 32 >At5g19030.3 68418.m02263 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 130 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFG 251 +FV G S +S+ ++ FSEFG Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFG 82 >At5g19030.2 68418.m02262 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 126 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFG 251 +FV G S +S+ ++ FSEFG Sbjct: 60 LFVKGFSDSVSEGRLKKVFSEFG 82 >At5g19030.1 68418.m02261 RNA recognition motif (RRM)-containing protein low similarity to Cold-inducible RNA-binding protein (Glycine-rich RNA-binding protein CIRP) from {Homo sapiens} SP|Q14011, {Rattus norvegicus} SP|Q61413,{Xenopus laevis} SP|O93235; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 172 Score = 27.5 bits (58), Expect = 3.8 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFG 251 +FV G S +S+ ++ FSEFG Sbjct: 79 LFVKGFSDSVSEGRLKKVFSEFG 101 >At5g06000.1 68418.m00665 eukaryotic translation initiation factor 3G, putative / eIF3g, putative similar to eukaryotic translation initiation factor 3g [Arabidopsis thaliana] GI:12407751; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 276 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVM 113 +G + +V D T SRGF F+ F + E + + Sbjct: 197 FGAVTRCHVAIDQKTSMSRGFGFVSFVSREDAQRAI 232 >At5g03580.1 68418.m00316 polyadenylate-binding protein, putative / PABP, putative similar to poly(A)-binding protein [Triticum aestivum] GI:1737492; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 101 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +3 Query: 51 GRSRGFAFIVFKAPESIDKVMAAGEHTINNKKV 149 G SRGFAFI F++ +S + M + + +K+ Sbjct: 54 GESRGFAFIEFESADSAGRAMLHMDGRLIGQKI 86 Score = 26.6 bits (56), Expect = 6.7 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 287 KNQRKGFCFITFES-EQVVNDLLKTPKRTIGGKEVDVKRATPK 412 + + +GF FI FES + +L R IG K + V+R TPK Sbjct: 53 RGESRGFAFIEFESADSAGRAMLHMDGRLIGQKILCVQR-TPK 94 >At2g21690.1 68415.m02580 RNA-binding protein, putative similar to Glycine-rich RNA-binding protein from {Sinapis alba} SP|P49311, {Brassica napus} SP|Q05966, {Arabidopsis thaliana} SP|Q03251; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 117 Score = 27.5 bits (58), Expect = 3.8 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESI-DKVM 113 +G + + D +TG+SR F F+ F+ +S+ D +M Sbjct: 30 FGNVIDSKIIYDRDTGKSRRFGFVTFEEEKSMTDAIM 66 >At2g16940.1 68415.m01952 RNA recognition motif (RRM)-containing protein Length = 561 Score = 27.5 bits (58), Expect = 3.8 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFGT 254 +++VG L +S+D++R F FG+ Sbjct: 286 RLYVGNLHINMSEDDLRKVFESFGS 310 >At1g54080.2 68414.m06163 oligouridylate-binding protein, putative similar to oligouridylate binding protein GI:6996560 from [Nicotiana plumbaginifolia] Length = 430 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +3 Query: 30 VKTDPNTGRSRGFAFIVFK 86 V D TGRSRGF F+ F+ Sbjct: 183 VMWDQKTGRSRGFGFVSFR 201 >At1g34140.1 68414.m04235 polyadenylate-binding protein, putative / PABP, putative non-consensus splice donor TA at exon 1; similar to polyadenylate-binding protein (poly(A)-binding protein) from [Triticum aestivum] GI:1737492, [Nicotiana tabacum] GI:7673355, {Arabidopsis thaliana} SP|P42731; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 407 Score = 27.5 bits (58), Expect = 3.8 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = +3 Query: 150 DPKKAKARHGKIFVGGLSSEISDDEIRNFFSEFG 251 DP + G +FV L I + ++ + FS FG Sbjct: 22 DPSNRMSGRGNVFVKNLDESIDNKQLCDMFSAFG 55 >At5g49760.1 68418.m06163 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 953 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/33 (36%), Positives = 23/33 (69%), Gaps = 4/33 (12%) Frame = -2 Query: 154 GSTFLLLM----VCSPAAMTLSIDSGALNTMKA 68 G++ LL++ +CS +A+T +D+ ALN +K+ Sbjct: 6 GASLLLILFFFQICSVSALTNGLDASALNALKS 38 >At3g63450.1 68416.m07144 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 399 Score = 27.1 bits (57), Expect = 5.1 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 54 RSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKARHGKI 185 + R F F+ F PE++ ++A G H + + +V K K + GK+ Sbjct: 191 QKRMFGFVTFMYPETVKSILAKGNPHFVCHSRVLVKPYKEK-GKV 234 >At2g43370.1 68415.m05392 U1 small nuclear ribonucleoprotein 70 kDa, putative Length = 333 Score = 27.1 bits (57), Expect = 5.1 Identities = 10/43 (23%), Positives = 23/43 (53%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVFKAPESIDKVMAAGEHTI 134 YG I+++ + TG SRG+ F+ ++ + + + H++ Sbjct: 87 YGRIKNLRLVRHIVTGASRGYGFVEYETEKEMLRAYEDAHHSL 129 >At5g18280.1 68418.m02149 apyrase (APY2) identical to apyrase GI:6006801, GI:7672685 from [Arabidopsis thaliana] Length = 472 Score = 26.6 bits (56), Expect = 6.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -1 Query: 191 DKNLPMSCFSLLWVYFLVVDG 129 ++NLP C L++ Y L++DG Sbjct: 414 EENLPYLCMDLVYQYTLLIDG 434 >At5g09970.1 68418.m01152 cytochrome P450 family protein Length = 536 Score = 26.6 bits (56), Expect = 6.7 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -2 Query: 64 PRDLPVFGSVFTL 26 PR +PVFGS+FTL Sbjct: 73 PRGIPVFGSLFTL 85 >At3g51950.1 68416.m05698 zinc finger (CCCH-type) family protein / RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM), PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 540 Score = 26.6 bits (56), Expect = 6.7 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 54 RSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKARHGKI 185 + R F F+ F PE++ ++A G H + + +V K K + GK+ Sbjct: 294 QKRMFGFVTFVYPETVKSILAKGNPHFVCDSRVLVKPYKEK-GKV 337 >At2g43410.1 68415.m05395 RNA recognition motif (RRM)-containing protein contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 1056 Score = 26.6 bits (56), Expect = 6.7 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +3 Query: 183 IFVGGLSSEISDDEIRNFFSEFG 251 ++VGG+ +S D++ FS+FG Sbjct: 252 LWVGGIGPNVSKDDLEEEFSKFG 274 >At1g12290.1 68414.m01421 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 884 Score = 26.6 bits (56), Expect = 6.7 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -2 Query: 391 IDLLSTNCS-FGSLKQIIYNLLRFKCDETEALSLVLCFV 278 +D+ +T + FG++K+ I +L++ D E+ S+ CF+ Sbjct: 374 VDVSTTYAANFGAVKERILPILKYSYDNLESESVKTCFL 412 >At5g44200.1 68418.m05408 nuclear cap-binding protein, putative similar to SP|P52298 20 kDa nuclear cap binding protein (CBP20) (NCBP interacting protein 1) {Homo sapiens}; non-consensus AT donor splice site at exon 4, AC acceptor splice site at exon 5; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 257 Score = 26.2 bits (55), Expect = 8.9 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +3 Query: 9 GEIESINVKTDPNTGRSRGFAFIVFKAPESID 104 GEI+ I + D NT GF F++F + E + Sbjct: 58 GEIKKIIMGLDKNTKTPCGFCFVLFYSREDTE 89 >At5g12440.1 68418.m01462 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 552 Score = 26.2 bits (55), Expect = 8.9 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 54 RSRGFAFIVFKAPESIDKVMAAGE-HTINNKKVDPKKAKARHGKI 185 + R F F+ F PE++ V+A G H I + +V K K + GK+ Sbjct: 295 QKRMFGFVSFAHPETVKVVLARGNPHFICDSRVLVKPYKEK-GKV 338 >At5g04770.1 68418.m00492 amino acid permease family protein similar to cationic amino acid transporter-1 [Rattus norvegicus] GI:1589917; contains Pfam profile PF00324: Amino acid permease Length = 583 Score = 26.2 bits (55), Expect = 8.9 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = -1 Query: 206 TAESSDKNLPMSCFSLLWVYFLVVDG 129 T ESS N+ M+ F + +++F++V G Sbjct: 209 TRESSKVNMIMTAFHIAFIFFVIVMG 234 >At3g55460.1 68416.m06159 SC35-like splicing factor, 30 kD (SCL30) nearly identical to SC35-like splicing factor SCL30, 30 kD [Arabidopsis thaliana] GI:9843657; Serine/arginine-rich protein/putative splicing factor, Arabidopdis thaliana, EMBL:AF099940; contains Pfam profile PF00076: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Length = 262 Score = 26.2 bits (55), Expect = 8.9 Identities = 9/26 (34%), Positives = 16/26 (61%) Frame = +3 Query: 6 YGEIESINVKTDPNTGRSRGFAFIVF 83 +G + + + D +G+ RGFAF+ F Sbjct: 70 FGPVRDVYIPRDYYSGQPRGFAFVEF 95 >At3g04080.1 68416.m00432 apyrase (APY1) identical to apyrase (Atapy1) GI:6002631 from [Arabidopsis thaliana] Length = 471 Score = 26.2 bits (55), Expect = 8.9 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -1 Query: 191 DKNLPMSCFSLLWVYFLVVDG 129 + NLP C L++ Y L+VDG Sbjct: 413 EDNLPYLCLDLVYQYTLLVDG 433 >At2g33440.1 68415.m04099 splicing factor family protein similar to Splicing factor U2AF 65 kDa subunit (U2 snRNP auxiliary factor large subunit) {Homo sapiens} SP|P26368, {Mus musculus} SP|P26369; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 247 Score = 26.2 bits (55), Expect = 8.9 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +3 Query: 180 KIFVGGLSSEISDDEIRNFFSEFG 251 KIF+GG S IS + + S FG Sbjct: 41 KIFIGGFSKAISSEMLMEIVSVFG 64 >At1g62170.1 68414.m07013 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 GI:9937311 from [Cucurbita maxima]; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 433 Score = 26.2 bits (55), Expect = 8.9 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 1/64 (1%) Frame = +3 Query: 138 NKKVDPKKAKARHGKIFVGGLS-SEISDDEIRNFFSEFGTS*KWRCPLTKQRTKERASVS 314 +KK PK A +G LS + +S D +NFFS +R + RT+ A S Sbjct: 150 SKKGGPKIAVV-NGMWMDQSLSVNPLSKDLFKNFFSAAFAQVDFRSKAEEVRTEVNAWAS 208 Query: 315 SHLN 326 SH N Sbjct: 209 SHTN 212 >At1g15890.1 68414.m01906 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 851 Score = 26.2 bits (55), Expect = 8.9 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = -2 Query: 409 WCCTLHIDLLSTNCSFGSLKQIIYNLLRFKCDETEALSLVLCFV 278 W +H+ L S++ F S+++ I +L+F D+ + + LCF+ Sbjct: 368 WQHVIHV-LNSSSHEFPSMEEKILPVLKFSYDDLKDEKVKLCFL 410 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,163,574 Number of Sequences: 28952 Number of extensions: 175974 Number of successful extensions: 971 Number of sequences better than 10.0: 167 Number of HSP's better than 10.0 without gapping: 677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 635399168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -