BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0142.Seq (626 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) 47 1e-05 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 47 1e-05 SB_46156| Best HMM Match : RNA_pol_delta (HMM E-Value=8.9) 47 1e-05 SB_45235| Best HMM Match : CBM_20 (HMM E-Value=0.91) 47 1e-05 SB_43774| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.21) 47 1e-05 SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) 47 1e-05 SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) 47 1e-05 SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) 47 1e-05 SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_26361| Best HMM Match : fn3 (HMM E-Value=0) 47 1e-05 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 47 1e-05 SB_25307| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_23523| Best HMM Match : LRR_1 (HMM E-Value=0.00074) 47 1e-05 SB_20950| Best HMM Match : PHD (HMM E-Value=0.2) 47 1e-05 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 47 1e-05 SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_15061| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_13351| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) 47 1e-05 SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_12242| Best HMM Match : RGS (HMM E-Value=0.75) 47 1e-05 SB_9189| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_5662| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) 47 1e-05 SB_56167| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.8) 47 1e-05 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_55413| Best HMM Match : LRR_1 (HMM E-Value=0.00077) 47 1e-05 SB_55031| Best HMM Match : GRP (HMM E-Value=5.3) 47 1e-05 SB_52825| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) 47 1e-05 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_39908| Best HMM Match : Prismane (HMM E-Value=3) 47 1e-05 SB_31266| Best HMM Match : PKI (HMM E-Value=1) 47 1e-05 SB_28964| Best HMM Match : Kinesin (HMM E-Value=2.4e-05) 47 1e-05 SB_26019| Best HMM Match : F5_F8_type_C (HMM E-Value=2.6e-29) 47 1e-05 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 47 1e-05 SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_21827| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_19785| Best HMM Match : SRR1 (HMM E-Value=8.8e-19) 47 1e-05 SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) 47 1e-05 SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) 47 1e-05 SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 47 1e-05 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 47 1e-05 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) 45 4e-05 SB_15919| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_9761| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.062 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.082 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 34 0.082 SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.082 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 34 0.11 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 33 0.14 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 33 0.14 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 33 0.14 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 33 0.14 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 33 0.14 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 33 0.14 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 33 0.14 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 33 0.14 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 33 0.14 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 33 0.14 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 33 0.14 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 33 0.14 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 33 0.14 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 33 0.14 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 33 0.14 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 33 0.14 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 33 0.14 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 33 0.14 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 33 0.14 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 33 0.14 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 33 0.14 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 33 0.14 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 33 0.14 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 33 0.14 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 33 0.14 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 33 0.14 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 33 0.14 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 33 0.14 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 33 0.14 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 33 0.14 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 33 0.14 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 33 0.14 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 33 0.14 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 33 0.14 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 33 0.14 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 33 0.14 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 33 0.14 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 33 0.14 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.14 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 33 0.14 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 33 0.14 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 33 0.14 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 33 0.14 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 33 0.14 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 33 0.14 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 33 0.19 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 33 0.19 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 33 0.19 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 33 0.19 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 33 0.19 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 33 0.19 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 33 0.19 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 33 0.19 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 33 0.19 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 33 0.19 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 33 0.19 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 33 0.19 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 33 0.19 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_31314| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 33 0.19 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 33 0.19 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 33 0.19 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 33 0.19 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 33 0.19 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 33 0.19 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 33 0.19 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 33 0.19 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 33 0.19 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 33 0.19 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 33 0.19 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 33 0.19 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 33 0.19 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 33 0.19 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 33 0.19 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 33 0.19 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 33 0.19 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 33 0.19 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 33 0.19 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 33 0.19 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 33 0.19 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 33 0.19 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 33 0.19 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 33 0.19 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 33 0.19 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 33 0.19 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 33 0.19 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 33 0.19 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 33 0.19 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 33 0.19 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 33 0.19 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 33 0.19 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 33 0.19 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 33 0.19 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 33 0.19 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 33 0.19 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 33 0.19 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 33 0.19 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 33 0.19 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 33 0.19 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 33 0.19 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_3195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_54086| Best HMM Match : Phage_integrase (HMM E-Value=0.68) 33 0.25 SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.25 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_44498| Best HMM Match : BA14K (HMM E-Value=7) 32 0.33 SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_15213| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.44 SB_30632| Best HMM Match : Acyltransferase (HMM E-Value=0.0097) 32 0.44 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59099| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59056| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_59022| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.4e-13) 31 0.58 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58787| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58740| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58562| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58322| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 31 0.58 SB_58087| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57919| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 31 0.58 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 31 0.58 SB_57517| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 31 0.58 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56899| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56712| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 31 0.58 SB_56631| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 31 0.58 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55775| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55081| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54479| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 31 0.58 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 31 0.58 >SB_58700| Best HMM Match : Ras (HMM E-Value=2.7e-15) Length = 857 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 603 SVAVTLRVTTTPAALNAPLQGASHSPF 629 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 626 HSPFRLRNCWEGR 638 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 20 SVAVTLRVTTTPAALNAPLQGASHSPF 46 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 43 HSPFRLRNCWEGR 55 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 381 SVAVTLRVTTTPAALNAPLQGASHSPF 407 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 404 HSPFRLRNCWEGR 416 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 1229 RPSQQLRSLNGEWRLM 1244 >SB_46156| Best HMM Match : RNA_pol_delta (HMM E-Value=8.9) Length = 138 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_45235| Best HMM Match : CBM_20 (HMM E-Value=0.91) Length = 817 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 612 SVAVTLRVTTTPAALNAPLQGASHSPF 638 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 635 HSPFRLRNCWEGR 647 >SB_43774| Best HMM Match : 2OG-FeII_Oxy (HMM E-Value=0.21) Length = 429 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_40417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 681 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 480 SVAVTLRVTTTPAALNAPLQGASHSPF 506 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 503 HSPFRLRNCWEGR 515 >SB_37089| Best HMM Match : Ribosomal_S9 (HMM E-Value=9.9) Length = 141 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 20 SVAVTLRVTTTPAALNAPLQGASHSPF 46 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 43 HSPFRLRNCWEGR 55 >SB_31470| Best HMM Match : SAND (HMM E-Value=5e-37) Length = 912 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_30809| Best HMM Match : Mab-21 (HMM E-Value=0) Length = 1710 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 746 SVAVTLRVTTTPAALNAPLQGASHSPF 772 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 769 HSPFRLRNCWEGR 781 >SB_28657| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3296 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 2367 SVAVTLRVTTTPAALNAPLQGASHSPF 2393 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 2390 HSPFRLRNCWEGR 2402 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 20 SVAVTLRVTTTPAALNAPLQGASHSPF 46 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 43 HSPFRLRNCWEGR 55 >SB_26361| Best HMM Match : fn3 (HMM E-Value=0) Length = 1898 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 566 SVAVTLRVTTTPAALNAPLQGASHSPF 592 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 589 HSPFRLRNCWEGR 601 >SB_25307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 54 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 18 SVAVTLRVTTTPAALNAPLQGASHSPF 44 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 41 HSPFRLRNCWEGR 53 >SB_23523| Best HMM Match : LRR_1 (HMM E-Value=0.00074) Length = 615 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 240 SVAVTLRVTTTPAALNAPLQGASHSPF 266 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 263 HSPFRLRNCWEGR 275 >SB_20950| Best HMM Match : PHD (HMM E-Value=0.2) Length = 298 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 143 SVAVTLRVTTTPAALNAPLQGASHSPF 169 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 166 HSPFRLRNCWEGR 178 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_18129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 367 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_15061| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 36 SVAVTLRVTTTPAALNAPLQGASHSPF 62 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 59 HSPFRLRNCWEGR 71 >SB_13351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 501 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_13245| Best HMM Match : Ion_trans (HMM E-Value=3.3e-25) Length = 816 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 38 SVAVTLRVTTTPAALNAPLQGASHSPF 64 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 61 HSPFRLRNCWEGR 73 >SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 31.1 bits (67), Expect = 0.77 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = -3 Query: 39 HSPFSVRNCWEG 4 HSPF +RNCWEG Sbjct: 32 HSPFRLRNCWEG 43 >SB_12242| Best HMM Match : RGS (HMM E-Value=0.75) Length = 737 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 121 SVAVTLRVTTTPAALNAPLQGASHSPF 147 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 144 HSPFRLRNCWEGR 156 >SB_9189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVTVTLRVTTTPAALNAPLQGASHSPF 35 >SB_5662| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 >SB_3686| Best HMM Match : Myotub-related (HMM E-Value=2.8e-08) Length = 629 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_56167| Best HMM Match : Plasmodium_HRP (HMM E-Value=6.8) Length = 285 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 596 SVAVTLRVTTTPAALNAPLQGASHSPF 622 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 619 HSPFRLRNCWEGR 631 >SB_55413| Best HMM Match : LRR_1 (HMM E-Value=0.00077) Length = 359 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_55031| Best HMM Match : GRP (HMM E-Value=5.3) Length = 487 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_52825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1141 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 430 SVAVTLRVTTTPAALNAPLQGASHSPF 456 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 453 HSPFRLRNCWEGR 465 >SB_47281| Best HMM Match : Adaptin_N (HMM E-Value=0) Length = 949 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 48 SVAVTLRVTTTPAALNAPLQGASHSPF 74 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 71 HSPFRLRNCWEGR 83 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 395 HSPFRLRNCWEGR 407 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 107 SVAVTLRVTTTPAALNAPLQGASHSPF 133 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 130 HSPFRLRNCWEGR 142 >SB_39908| Best HMM Match : Prismane (HMM E-Value=3) Length = 456 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 298 SVAVTLRVTTTPAALNAPLQGASHSPF 324 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 321 HSPFRLRNCWEGR 333 Score = 27.5 bits (58), Expect = 9.4 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 43 LPFAIQRAQLLGRA 2 +PFAIQ AQLLGRA Sbjct: 3 VPFAIQAAQLLGRA 16 >SB_31266| Best HMM Match : PKI (HMM E-Value=1) Length = 1507 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_28964| Best HMM Match : Kinesin (HMM E-Value=2.4e-05) Length = 296 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 42 SVAVTLRVTTTPAALNAPLQGASHSPF 68 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 65 HSPFRLRNCWEGR 77 >SB_26019| Best HMM Match : F5_F8_type_C (HMM E-Value=2.6e-29) Length = 438 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 163 SVAVTLRVTTTPAALNAPLQGASHSPF 189 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 186 HSPFRLRNCWEGR 198 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 558 SVAVTLRVTTTPAALNAPLQGASHSPF 584 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 581 HSPFRLRNCWEGR 593 >SB_24420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 608 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 51 SVAVTLRVTTTPAALNAPLQGASHSPF 77 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 74 HSPFRLRNCWEGR 86 >SB_21827| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 708 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 321 SVAVTLRVTTTPAALNAPLQGASHSPF 347 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 344 HSPFRLRNCWEGR 356 >SB_19785| Best HMM Match : SRR1 (HMM E-Value=8.8e-19) Length = 735 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 356 SVAVTLRVTTTPAALNAPLQGASHSPF 382 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 379 HSPFRLRNCWEGR 391 >SB_19262| Best HMM Match : Laminin_EGF (HMM E-Value=0.36) Length = 1173 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 49 SVAVTLRVTTTPAALNAPLQGASHSPF 75 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 72 HSPFRLRNCWEGR 84 >SB_14096| Best HMM Match : DUF595 (HMM E-Value=2.1) Length = 233 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_13740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_12193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 457 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 184 SVAVTLRVTTTPAALNAPLQGASHSPF 210 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 207 HSPFRLRNCWEGR 219 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/27 (85%), Positives = 23/27 (85%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAALNAPLQGAS F Sbjct: 9 SVAVTLRVTTTPAALNAPLQGASHSPF 35 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 32 HSPFRLRNCWEGR 44 >SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 45.2 bits (102), Expect = 4e-05 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 477 IKRGGCGGYAQRDXYTCQR 421 +KRGGCGGYAQRD YTCQR Sbjct: 88 LKRGGCGGYAQRDRYTCQR 106 Score = 31.5 bits (68), Expect = 0.58 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEW 40 RPSQQLR+LNGEW Sbjct: 68 RPSQQLRSLNGEW 80 >SB_5222| Best HMM Match : Ras (HMM E-Value=2.9e-09) Length = 181 Score = 45.2 bits (102), Expect = 4e-05 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -3 Query: 477 IKRGGCGGYAQRDXYTCQR 421 +KRGGCGGYAQRD YTCQR Sbjct: 163 LKRGGCGGYAQRDRYTCQR 181 Score = 31.5 bits (68), Expect = 0.58 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEW 40 RPSQQLR+LNGEW Sbjct: 143 RPSQQLRSLNGEW 155 >SB_15919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 43.6 bits (98), Expect = 1e-04 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +1 Query: 430 SVXVTLRVTTTPAALNAPLQGASGGTF 510 SV VTLRVTTTPAAL APLQGAS F Sbjct: 20 SVAVTLRVTTTPAALYAPLQGASHSPF 46 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 43 HSPFRLRNCWEGR 55 >SB_9761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 41.1 bits (92), Expect = 7e-04 Identities = 20/30 (66%), Positives = 21/30 (70%) Frame = -3 Query: 513 PESAT*RAL*RRIKRGGCGGYAQRDXYTCQ 424 PE R+L RRIK G GGYAQRD YTCQ Sbjct: 4 PEWPMGRSLYRRIKPVGSGGYAQRDRYTCQ 33 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 34.7 bits (76), Expect = 0.062 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLRTLNGEW+++ Sbjct: 78 RPSQQLRTLNGEWRLM 93 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 34.3 bits (75), Expect = 0.082 Identities = 13/19 (68%), Positives = 17/19 (89%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVN 58 RPSQQLR+LNGEW+++ N Sbjct: 1102 RPSQQLRSLNGEWRLMRQN 1120 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 34.3 bits (75), Expect = 0.082 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNILLKFALNFC*ISSFFNQ*AEIGKIPYKSKE*TEIGL 169 RPSQQLR+LNGEW+++ +L + S F Q + + ++ S++ +G+ Sbjct: 73 RPSQQLRSLNGEWRLMRYFLLTHLCASTEIPRSTFTQASSVQRLFGTSQDDAGVGV 128 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 34.3 bits (75), Expect = 0.082 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -3 Query: 69 FNKILTLTICHSPFSVRNCWEGR 1 F I T HSPF +RNCWEGR Sbjct: 362 FAYIATEGASHSPFRLRNCWEGR 384 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 33.9 bits (74), Expect = 0.11 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNILLKFAL 79 RPSQQLR+LNGEW+++ +L L Sbjct: 872 RPSQQLRSLNGEWRLMRYFLLTHLIL 897 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNILL 67 RPSQQLR+LNGEW+++ N LL Sbjct: 45 RPSQQLRSLNGEWRLMR-NFLL 65 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 101 RPSQQLRSLNGEWRLMRYFLL 121 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 64 RPSQQLRSLNGEWRLMRYFLL 84 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 79 RPSQQLRSLNGEWRLMRYFLL 99 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 88 RPSQQLRSLNGEWRLMRYFLL 108 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 67 RPSQQLRSLNGEWRLMRYFLL 87 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 153 RPSQQLRSLNGEWRLMRYFLL 173 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 78 RPSQQLRSLNGEWRLMRYFLL 98 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 50 RPSQQLRSLNGEWRLMRYFLL 70 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 127 RPSQQLRSLNGEWRLMRYFLL 147 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 61 RPSQQLRSLNGEWRLMRYFLL 81 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 192 RPSQQLRSLNGEWRLMRYFLL 212 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 96 RPSQQLRSLNGEWRLMRYFLL 116 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 86 RPSQQLRSLNGEWRLMRYFLL 106 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 99 RPSQQLRSLNGEWRLMRYFLL 119 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 252 RPSQQLRSLNGEWRLMRYFLL 272 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 87 RPSQQLRSLNGEWRLMRYFLL 107 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 79 RPSQQLRSLNGEWRLMRYFLL 99 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 114 RPSQQLRSLNGEWRLMRYFLL 134 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 61 RPSQQLRSLNGEWRLMRYFLL 81 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 96 RPSQQLRSLNGEWRLMRYFLL 116 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNILLK 70 RPSQQLR+LNGEW+++ + K Sbjct: 139 RPSQQLRSLNGEWRLMRRQVRAK 161 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 112 RPSQQLRSLNGEWRLMRYFLL 132 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 67 RPSQQLRSLNGEWRLMRYFLL 87 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 98 RPSQQLRSLNGEWRLMRYFLL 118 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 127 RPSQQLRSLNGEWRLMRYFLL 147 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 139 RPSQQLRSLNGEWRLMRYFLL 159 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 71 RPSQQLRSLNGEWRLMRYFLL 91 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 164 RPSQQLRSLNGEWRLMRYFLL 184 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 135 RPSQQLRSLNGEWRLMRYFLL 155 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 100 RPSQQLRSLNGEWRLMRYFLL 120 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 123 RPSQQLRSLNGEWRLMRYFLL 143 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 123 RPSQQLRSLNGEWRLMRYFLL 143 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 123 RPSQQLRSLNGEWRLMRYFLL 143 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 104 RPSQQLRSLNGEWRLMRYFLL 124 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 63 RPSQQLRSLNGEWRLMRYFLL 83 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 147 RPSQQLRSLNGEWRLMRYFLL 167 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 63 RPSQQLRSLNGEWRLMRYFLL 83 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 82 RPSQQLRSLNGEWRLMRYFLL 102 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 115 RPSQQLRSLNGEWRLMRYFLL 135 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 106 RPSQQLRSLNGEWRLMRYFLL 126 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 130 RPSQQLRSLNGEWRLMRYFLL 150 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 80 RPSQQLRSLNGEWRLMRYFLL 100 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 173 RPSQQLRSLNGEWRLMRYFLL 193 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 221 RPSQQLRSLNGEWRLMRYFLL 241 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 98 RPSQQLRSLNGEWRLMRYFLL 118 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 74 RPSQQLRSLNGEWRLMRYFLL 94 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 185 RPSQQLRSLNGEWRLMRYFLL 205 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 97 RPSQQLRSLNGEWRLMRYFLL 117 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 155 RPSQQLRSLNGEWRLMRYFLL 175 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 62 RPSQQLRSLNGEWRLMRYFLL 82 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 691 RPSQQLRSLNGEWRLMRYFLL 711 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 78 RPSQQLRSLNGEWRLMRYFLL 98 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 200 RPSQQLRSLNGEWRLMRYFLL 220 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 61 RPSQQLRSLNGEWRLMRYFLL 81 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 109 RPSQQLRSLNGEWRLMRYFLL 129 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 110 RPSQQLRSLNGEWRLMRYFLL 130 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 118 RPSQQLRSLNGEWRLMRYFLL 138 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 224 RPSQQLRSLNGEWRLMRYFLL 244 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 483 RPSQQLRSLNGEWRLMRYFLL 503 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 112 RPSQQLRSLNGEWRLMRYFLL 132 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 305 RPSQQLRSLNGEWRLMRYFLL 325 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 73 RPSQQLRSLNGEWRLMRYFLL 93 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 109 RPSQQLRSLNGEWRLMRYFLL 129 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 143 RPSQQLRSLNGEWRLMRYFLL 163 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 102 RPSQQLRSLNGEWRLMRYFLL 122 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 112 RPSQQLRSLNGEWRLMRYFLL 132 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 112 RPSQQLRSLNGEWRLMRYFLL 132 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 113 RPSQQLRSLNGEWRLMRYFLL 133 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 84 RPSQQLRSLNGEWRLMRYFLL 104 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 122 RPSQQLRSLNGEWRLMRYFLL 142 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 215 RPSQQLRSLNGEWRLMRYFLL 235 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 70 RPSQQLRSLNGEWRLMRYFLL 90 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 122 RPSQQLRSLNGEWRLMRYFLL 142 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 88 RPSQQLRSLNGEWRLMRYFLL 108 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 107 RPSQQLRSLNGEWRLMRYFLL 127 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 96 RPSQQLRSLNGEWRLMRYFLL 116 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 108 RPSQQLRSLNGEWRLMRYFLL 128 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 77 RPSQQLRSLNGEWRLMRYFLL 97 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 83 RPSQQLRSLNGEWRLMRYFLL 103 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 101 RPSQQLRSLNGEWRLMRYFLL 121 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 120 RPSQQLRSLNGEWRLMRYFLL 140 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 126 RPSQQLRSLNGEWRLMRYFLL 146 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 143 RPSQQLRSLNGEWRLMRYFLL 163 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 77 RPSQQLRSLNGEWRLMRYFLL 97 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 89 RPSQQLRSLNGEWRLMRYFLL 109 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 88 RPSQQLRSLNGEWRLMRYFLL 108 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 165 RPSQQLRSLNGEWRLMRYFLL 185 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 108 RPSQQLRSLNGEWRLMRYFLL 128 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 94 RPSQQLRSLNGEWRLMRYFLL 114 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 93 RPSQQLRSLNGEWRLMRYFLL 113 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 127 RPSQQLRSLNGEWRLMRYFLL 147 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 94 RPSQQLRSLNGEWRLMRYFLL 114 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 133 RPSQQLRSLNGEWRLMRYFLL 153 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 104 RPSQQLRSLNGEWRLMRYFLL 124 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 206 RPSQQLRSLNGEWRLMRYFLL 226 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 118 RPSQQLRSLNGEWRLMRYFLL 138 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 96 RPSQQLRSLNGEWRLMRYFLL 116 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 144 RPSQQLRSLNGEWRLMRYFLL 164 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 75 RPSQQLRSLNGEWRLMRYFLL 95 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 158 RPSQQLRSLNGEWRLMRYFLL 178 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 191 RPSQQLRSLNGEWRLMRYFLL 211 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 141 RPSQQLRSLNGEWRLMRYFLL 161 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 73 RPSQQLRSLNGEWRLMRYFLL 93 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 76 RPSQQLRSLNGEWRLMRYFLL 96 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 108 RPSQQLRSLNGEWRLMRYFLL 128 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 165 RPSQQLRSLNGEWRLMRYFLL 185 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 65 RPSQQLRSLNGEWRLMRYFLL 85 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 110 RPSQQLRSLNGEWRLMRYFLL 130 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 124 RPSQQLRSLNGEWRLMRYFLL 144 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 132 RPSQQLRSLNGEWRLMRYFLL 152 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 111 RPSQQLRSLNGEWRLMRYFLL 131 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 111 RPSQQLRSLNGEWRLMRYFLL 131 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 132 RPSQQLRSLNGEWRLMRYFLL 152 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 146 RPSQQLRSLNGEWRLMRYFLL 166 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 120 RPSQQLRSLNGEWRLMRYFLL 140 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 147 RPSQQLRSLNGEWRLMRYFLL 167 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 345 RPSQQLRSLNGEWRLMRYFLL 365 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 91 RPSQQLRSLNGEWRLMRYFLL 111 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 54 RPSQQLRSLNGEWRLMRYFLL 74 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 65 RPSQQLRSLNGEWRLMRYFLL 85 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 95 RPSQQLRSLNGEWRLMRYFLL 115 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 286 RPSQQLRSLNGEWRLMRYFLL 306 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 120 RPSQQLRSLNGEWRLMRYFLL 140 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 87 RPSQQLRSLNGEWRLMRYFLL 107 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 63 RPSQQLRSLNGEWRLMRYFLL 83 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 243 RPSQQLRSLNGEWRLMRYFLL 263 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 102 RPSQQLRSLNGEWRLMRYFLL 122 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 758 RPSQQLRSLNGEWRLMRYFLL 778 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 78 RPSQQLRSLNGEWRLMRYFLL 98 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 226 RPSQQLRSLNGEWRLMRYFLL 246 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 154 RPSQQLRSLNGEWRLMRYFLL 174 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 69 RPSQQLRSLNGEWRLMRYFLL 89 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 59 RPSQQLRSLNGEWRLMRYFLL 79 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 124 RPSQQLRSLNGEWRLMRYFLL 144 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 71 RPSQQLRSLNGEWRLMRYFLL 91 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 148 RPSQQLRSLNGEWRLMRYFLL 168 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 60 RPSQQLRSLNGEWRLMRYFLL 80 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 76 RPSQQLRSLNGEWRLMRYFLL 96 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 99 RPSQQLRSLNGEWRLMRYFLL 119 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 60 RPSQQLRSLNGEWRLMRYFLL 80 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 80 RPSQQLRSLNGEWRLMRYFLL 100 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 106 RPSQQLRSLNGEWRLMRYFLL 126 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 83 RPSQQLRSLNGEWRLMRYFLL 103 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 101 RPSQQLRSLNGEWRLMRYFLL 121 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 160 RPSQQLRSLNGEWRLMRYFLL 180 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 108 RPSQQLRSLNGEWRLMRYFLL 128 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 403 RPSQQLRSLNGEWRLMRYFLL 423 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 80 RPSQQLRSLNGEWRLMRYFLL 100 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 93 RPSQQLRSLNGEWRLMRYFLL 113 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 33.5 bits (73), Expect = 0.14 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIVSVNIL 64 RPSQQLR+LNGEW+++ +L Sbjct: 476 RPSQQLRSLNGEWRLMRYFLL 496 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 472 HSPFRLRNCWEGR 484 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 54 RPSQQLRSLNGEWRLM 69 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 19 HSPFRLRNCWEGR 31 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 4 HSPFRLRNCWEGR 16 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 68 RPSQQLRSLNGEWRLM 83 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 57 RPSQQLRSLNGEWRLM 72 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 59 RPSQQLRSLNGEWRLM 74 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 216 HSPFRLRNCWEGR 228 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 58 RPSQQLRSLNGEWRLM 73 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 19 HSPFRLRNCWEGR 31 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 76 RPSQQLRSLNGEWRLM 91 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 65 HSPFRLRNCWEGR 77 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 45 RPSQQLRSLNGEWRLM 60 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 171 RPSQQLRSLNGEWRLM 186 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 19 HSPFRLRNCWEGR 31 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 60 RPSQQLRSLNGEWRLM 75 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 646 HSPFRLRNCWEGR 658 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 72 RPSQQLRSLNGEWRLM 87 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 19 HSPFRLRNCWEGR 31 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 19 HSPFRLRNCWEGR 31 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 371 HSPFRLRNCWEGR 383 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 185 RPSQQLRSLNGEWRLM 200 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 116 RPSQQLRSLNGEWRLM 131 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 70 RPSQQLRSLNGEWRLM 85 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 33.1 bits (72), Expect = 0.19 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEW 40 RPSQQLRTLNGEW Sbjct: 69 RPSQQLRTLNGEW 81 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 73 RPSQQLRSLNGEWRLM 88 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 75 RPSQQLRSLNGEWRLM 90 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 79 RPSQQLRSLNGEWRLM 94 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 287 HSPFRLRNCWEGR 299 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 60 RPSQQLRSLNGEWRLM 75 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 55 RPSQQLRSLNGEWRLM 70 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 19 HSPFRLRNCWEGR 31 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 555 HSPFRLRNCWEGR 567 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 56 RPSQQLRSLNGEWRLM 71 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 33.1 bits (72), Expect = 0.19 Identities = 12/16 (75%), Positives = 16/16 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEWQIV 49 RPSQQLR+LNGEW+++ Sbjct: 70 RPSQQLRSLNGEWRLM 85 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 19 HSPFRLRNCWEGR 31 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 33.1 bits (72), Expect = 0.19 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -3 Query: 39 HSPFSVRNCWEGR 1 HSPF +RNCWEGR Sbjct: 179 HSPFRLRNCWEGR 191 Score = 31.5 bits (68), Expect = 0.58 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +2 Query: 2 RPSQQLRTLNGEW 40 RPSQQLR+LNGEW Sbjct: 554 RPSQQLRSLNGEW 566 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,838,164 Number of Sequences: 59808 Number of extensions: 359954 Number of successful extensions: 7986 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7986 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1560464625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -