BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0137.Seq (642 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pom... 27 3.0 SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein Sap49|Schizo... 27 3.0 SPAC13G6.11c |erg12||mevalonate kinase Erg12 |Schizosaccharomyce... 26 5.3 SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyce... 25 7.0 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 25 7.0 SPAPB1A10.11c |||glutamyl-tRNA synthetase, mitochondrial|Schizos... 25 9.3 >SPBC11B10.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 204 Score = 26.6 bits (56), Expect = 3.0 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 1/47 (2%) Frame = +1 Query: 337 PPLPAPDRYR*RIHRSATATGASKVKP-PAPKATENRVHARCEET*P 474 PP P Y + A AS P PAP A++NR + + P Sbjct: 58 PPSGPPPSYSNSAAPATPAASASSAAPAPAPAASQNRAYGAAPQPYP 104 >SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein Sap49|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 26.6 bits (56), Expect = 3.0 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = +1 Query: 421 APKATENRVHARCEET*PADRSKKTPAPPDARNQP 525 A A +N+V + T P S TPAP A N P Sbjct: 194 AAAAKKNKVAVTPQSTLPPGFSPATPAPTSAANTP 228 >SPAC13G6.11c |erg12||mevalonate kinase Erg12 |Schizosaccharomyces pombe|chr 1|||Manual Length = 404 Score = 25.8 bits (54), Expect = 5.3 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 95 STKVSEQGVGELTASTPLQEQAIADALDG 9 STK QGV EL P +I DA+DG Sbjct: 239 STKKLVQGVFELKERLPTVIDSIIDAIDG 267 >SPAPB15E9.01c ||SPAPB18E9.06c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1036 Score = 25.4 bits (53), Expect = 7.0 Identities = 22/99 (22%), Positives = 45/99 (45%), Gaps = 2/99 (2%) Frame = +3 Query: 291 ARKRRLVSSQINATISATTSARPIPLTDSPFSHSHGCQQSKTTCAKSNRK*STRQVRGNV 470 A L SS +N+T SAT ++ + T + S + S + + ++ ++ + V Sbjct: 190 ATSSSLASSSLNSTTSATATSSSLSSTAASNSATSSSLASSSLNSTTSATATSSSISSTV 249 Query: 471 -ARRPL-KKNASTAGCQESAPARNYRDRDKTDLAAQYPA 581 + PL N++TA SA + + + + L + P+ Sbjct: 250 SSSTPLTSSNSTTAATSASATSSSAQYNTSSLLPSSTPS 288 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 25.4 bits (53), Expect = 7.0 Identities = 17/64 (26%), Positives = 23/64 (35%) Frame = +1 Query: 340 PLPAPDRYR*RIHRSATATGASKVKPPAPKATENRVHARCEET*PADRSKKTPAPPDARN 519 PLP+ D + +A PP PK++ A P+ PAP A Sbjct: 1025 PLPSADAPPIPVPSTAPPVPIPTSTPPVPKSSSGAPSAPPPVPAPSSEIPSIPAPSGAPP 1084 Query: 520 QPQP 531 P P Sbjct: 1085 VPAP 1088 >SPAPB1A10.11c |||glutamyl-tRNA synthetase, mitochondrial|Schizosaccharomyces pombe|chr 1|||Manual Length = 526 Score = 25.0 bits (52), Expect = 9.3 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 58 VNSPTPCSLTLVDDPNQFHGLAADQLTD 141 V+ P + T +D ++H ++ D LTD Sbjct: 136 VSYSVPIATTKIDSSTKYHEISIDDLTD 163 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,662,591 Number of Sequences: 5004 Number of extensions: 53827 Number of successful extensions: 180 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 169 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 180 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -