BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0134.Seq (532 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 2.2 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.8 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 21 6.8 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.8 AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 21 8.9 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -2 Query: 159 GVFNFKLSFRFSLYLIFASNKQKKFFGHDV*ITTLRSL 46 G N L L+F K K +GH + +T L L Sbjct: 207 GTENLDLVLPIYSQLVFMCKKINKLYGHQLLLTILTYL 244 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 337 LPPNCSERF*KTMLRCNSSPRN 272 LP NC +R L ++ PRN Sbjct: 429 LPENCQKRHPFAYLPFSAGPRN 450 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 21.0 bits (42), Expect = 6.8 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -1 Query: 79 TRCINNYPSFAS 44 T C NNYP +++ Sbjct: 250 TNCYNNYPYYSN 261 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 337 LPPNCSERF*KTMLRCNSSPRN 272 LP NC +R L ++ PRN Sbjct: 429 LPENCQKRHPFAYLPFSAGPRN 450 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 20.6 bits (41), Expect = 8.9 Identities = 6/14 (42%), Positives = 9/14 (64%) Frame = +1 Query: 463 RCPPTRSGACRWLP 504 RCPP +C++ P Sbjct: 32 RCPPIYEPSCQYSP 45 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 104,882 Number of Sequences: 336 Number of extensions: 2170 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -