BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0129.Seq (695 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 25 0.59 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 25 0.59 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 25 0.59 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 25 0.59 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 2.4 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 3.2 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 3.2 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 23 3.2 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 22 4.2 AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 22 5.5 AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. 22 5.5 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 7.3 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 21 7.3 AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory recept... 21 7.3 AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory recept... 21 7.3 AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory recept... 21 7.3 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 9.6 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.59 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 337 HCWSWCMWLT*NSDQNW--LLGWTRKLKR 417 H W W +WL Q W L WT K +R Sbjct: 463 HAWIWLLWLL---SQTWITLHIWTPKCER 488 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.59 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 337 HCWSWCMWLT*NSDQNW--LLGWTRKLKR 417 H W W +WL Q W L WT K +R Sbjct: 463 HAWIWLLWLL---SQTWITLHIWTPKCER 488 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.59 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 337 HCWSWCMWLT*NSDQNW--LLGWTRKLKR 417 H W W +WL Q W L WT K +R Sbjct: 463 HAWIWLLWLL---SQTWITLHIWTPKCER 488 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 25.0 bits (52), Expect = 0.59 Identities = 12/29 (41%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +1 Query: 337 HCWSWCMWLT*NSDQNW--LLGWTRKLKR 417 H W W +WL Q W L WT K +R Sbjct: 463 HAWIWLLWLL---SQTWITLHIWTPKCER 488 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = -3 Query: 162 RAKVFWSCVATSEAEPRATSAVH 94 RAK++ CV T+ P A S ++ Sbjct: 27 RAKIYALCVVTALVTPSALSIIY 49 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.2 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = -1 Query: 431 PFVLGRFNFLVQPSSQFWSEFHVSHIH 351 P + G ++L + FW+E ++H Sbjct: 1179 PLIRGEVHYLNRNEETFWNELIEQYLH 1205 Score = 21.4 bits (43), Expect = 7.3 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +1 Query: 337 HCWSWCMWL 363 H W W +WL Sbjct: 450 HAWIWLVWL 458 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 22.6 bits (46), Expect = 3.2 Identities = 7/27 (25%), Positives = 14/27 (51%) Frame = -1 Query: 431 PFVLGRFNFLVQPSSQFWSEFHVSHIH 351 P + G ++L + FW+E ++H Sbjct: 1179 PLIRGEVHYLNRNEETFWNELIEQYLH 1205 Score = 21.4 bits (43), Expect = 7.3 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +1 Query: 337 HCWSWCMWL 363 H W W +WL Sbjct: 450 HAWIWLVWL 458 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 22.6 bits (46), Expect = 3.2 Identities = 17/68 (25%), Positives = 28/68 (41%) Frame = +3 Query: 237 NWCDGSYTFGVGLATYLCSKEIYVMEHEYYSGLSLLVMVYVAHVKFGPKLAAWLDKEVEA 416 +WC S L+T + Y + YYS + L ++H +FG L K + Sbjct: 234 SWCSSSQPV---LSTTNSTTNCY-NNYPYYSNMDYLSSSTMSHSQFGNGLETSWGKSRDE 289 Query: 417 TENEWNEG 440 + +N G Sbjct: 290 SSWFYNSG 297 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +2 Query: 608 RRLDYQLEKSNVERRLAQKHMVD 676 RRL+ LEKS + +H VD Sbjct: 148 RRLEMSLEKSGLFSSKTSEHSVD 170 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 464 GGRNRGREDGAVARAGQELLIQAKKENV 547 GGR+ R DG +E I + ENV Sbjct: 97 GGRDGDRGDGGGEEKKREFYIPPEVENV 124 >AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. Length = 46 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -3 Query: 255 RTRHTSFRVEELEPFF 208 RT TS+++EELE F Sbjct: 1 RTTFTSYQLEELEKAF 16 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 7.3 Identities = 5/9 (55%), Positives = 6/9 (66%) Frame = +1 Query: 337 HCWSWCMWL 363 H W W +WL Sbjct: 217 HAWIWLVWL 225 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 21.4 bits (43), Expect = 7.3 Identities = 12/45 (26%), Positives = 22/45 (48%) Frame = +2 Query: 191 DLALFLKNGSNSSTRKLV*RVLHFWCGSGNIPVQQGNLCNGARIL 325 D+ L L + + +T+ + LH W G+G + + N +IL Sbjct: 87 DVELVLTD-TKQNTKSFIYHFLHSWLGTGLLTSRGPKWQNRRKIL 130 >AM292351-1|CAL23163.2| 394|Tribolium castaneum gustatory receptor candidate 30 protein. Length = 394 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/35 (22%), Positives = 19/35 (54%) Frame = +2 Query: 590 AYSEVKRRLDYQLEKSNVERRLAQKHMVDWIVSNV 694 +YS + +DY + + V + + +H W+ ++V Sbjct: 198 SYSHIFSLMDYNIVMALVLQFITLQHTFIWVFNDV 232 >AM292350-1|CAL23162.2| 429|Tribolium castaneum gustatory receptor candidate 29 protein. Length = 429 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/35 (22%), Positives = 19/35 (54%) Frame = +2 Query: 590 AYSEVKRRLDYQLEKSNVERRLAQKHMVDWIVSNV 694 +YS + +DY + + V + + +H W+ ++V Sbjct: 198 SYSHIFSLMDYNIVMALVLQFITLQHTFIWVFNDV 232 >AM292328-1|CAL23140.2| 429|Tribolium castaneum gustatory receptor candidate 7 protein. Length = 429 Score = 21.4 bits (43), Expect = 7.3 Identities = 8/35 (22%), Positives = 19/35 (54%) Frame = +2 Query: 590 AYSEVKRRLDYQLEKSNVERRLAQKHMVDWIVSNV 694 +YS + +DY + + V + + +H W+ ++V Sbjct: 198 SYSHIFSLMDYNIVMALVLQFITLQHTFIWVFNDV 232 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.0 bits (42), Expect = 9.6 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 532 QEGERAPAARGRLQGEA 582 +E ERAPA R G+A Sbjct: 271 EEAERAPAPAVRAAGDA 287 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,372 Number of Sequences: 336 Number of extensions: 3549 Number of successful extensions: 24 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18322480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -