BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0117.Seq (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC11D3.10 |||nifs homolog|Schizosaccharomyces pombe|chr 1|||Ma... 26 6.7 SPAC1002.11 |gaa1||GPI-anchor transamidase complex subunit Gaa1 ... 25 8.8 >SPAC11D3.10 |||nifs homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 434 Score = 25.8 bits (54), Expect = 6.7 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -2 Query: 469 SRIDLGFSVRFFR*SVSTQVVKPPSSLRKGTIPDIPCN 356 SR + G V F + S ++K S +RKG +IP N Sbjct: 356 SRFESGIRVSFGLYNTSKDIIKFISVIRKGLALNIPLN 393 >SPAC1002.11 |gaa1||GPI-anchor transamidase complex subunit Gaa1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 581 Score = 25.4 bits (53), Expect = 8.8 Identities = 12/29 (41%), Positives = 19/29 (65%) Frame = +2 Query: 272 RSVMEKLNLLHKSFF*RYIRDRIHVYVSV 358 RS+ L LH+SFF +I D +H ++S+ Sbjct: 343 RSLNNLLEHLHQSFFFYFILDHLH-FISI 370 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,111,946 Number of Sequences: 5004 Number of extensions: 62243 Number of successful extensions: 136 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -