BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0112.Seq (663 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4382| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) 30 1.5 SB_6680| Best HMM Match : Astacin (HMM E-Value=0) 29 4.5 >SB_4382| Best HMM Match : Lectin_C (HMM E-Value=3.8e-22) Length = 492 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/56 (39%), Positives = 29/56 (51%) Frame = -1 Query: 390 TMRIRIRLYPSS*VIK*STCGRNILFRRILPTIV*PKK*TRRQYLLSIVLGQLIYC 223 T+R R RL I+ + G NILF R+ PT P K R++ +L L IYC Sbjct: 141 TLRGRARLAD----IRITARGENILFTRLSPTYTVPNK-PRKESILFTRLTTYIYC 191 >SB_6680| Best HMM Match : Astacin (HMM E-Value=0) Length = 637 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +3 Query: 354 SWMDTIVYGYASYTDTIIQSMKQLFHGLILKLWY 455 S + +V Y+ Y D++ + KQ+F G L L+Y Sbjct: 403 SMEEQVVGPYSLYDDSLFEGKKQIFAGRTLDLYY 436 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,221,990 Number of Sequences: 59808 Number of extensions: 294330 Number of successful extensions: 516 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 466 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 515 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1705624125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -