BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0111.Seq (581 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 27 0.59 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 25 2.4 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 25 2.4 AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 pr... 25 2.4 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 24 3.1 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 24 4.1 DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. 23 7.2 DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. 23 7.2 DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted ... 23 9.5 AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B... 23 9.5 AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B... 23 9.5 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 26.6 bits (56), Expect = 0.59 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -3 Query: 354 VQYRGFEPYPSWHHGETSHW 295 + Y GFEPY H G+ W Sbjct: 1335 ISYYGFEPYERNHFGKEKKW 1354 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 24.6 bits (51), Expect = 2.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 375 YEWSHPPVQYRGFEPYPSWHHGETSHW 295 Y S V Y GFEPY G W Sbjct: 1322 YRISEEIVTYYGFEPYEQNQIGSDGRW 1348 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 24.6 bits (51), Expect = 2.4 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -3 Query: 375 YEWSHPPVQYRGFEPYPSWHHGETSHW 295 Y S V Y GFEPY G W Sbjct: 1323 YRISEEIVTYYGFEPYEQNQIGSDGRW 1349 >AY748847-1|AAV28193.1| 104|Anopheles gambiae cytochrome P450 protein. Length = 104 Score = 24.6 bits (51), Expect = 2.4 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 2/38 (5%) Frame = +3 Query: 336 QIHDIV--LVGGSTRIPKVQKLLKISLMERSSTNLLTL 443 Q+H + + GGS R P ++ L ++ L+ER L L Sbjct: 60 QVHQEIDSIFGGSDRAPTMRDLNEMKLLERCLKETLRL 97 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.1 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 536 VTSSNSRSCTPQNCHRAR*QPEQLHHKLRPRQ 441 VTS T + + + QP QLH +L+ +Q Sbjct: 198 VTSPQPSQVTSRQLQQQQLQPNQLHQQLQQQQ 229 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 23.8 bits (49), Expect = 4.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +3 Query: 69 HFVPGVQEEIQKGPRYQQES 128 H PG+QE I + R QQE+ Sbjct: 2076 HLSPGLQEVIDRFVRIQQEN 2095 >DQ974162-1|ABJ52802.1| 418|Anopheles gambiae serpin 3 protein. Length = 418 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = +2 Query: 338 NPRYCTGGWLHSYPQGAEAPEDFFNGK 418 N Y G W +P A FF G+ Sbjct: 197 NTIYFKGSWSIPFPTNATVERPFFTGR 223 >DQ182015-1|ABA56307.1| 353|Anopheles gambiae G(alpha)q2 protein. Length = 353 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 546 GKGCYIKQQQILHSSELS 493 GK +IKQ +I+H S S Sbjct: 45 GKSTFIKQMRIIHGSGYS 62 >DQ370046-1|ABD18607.1| 125|Anopheles gambiae putative secreted polypeptide protein. Length = 125 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +2 Query: 347 YCTGGWLHSYPQGAEAPEDF 406 YC G++ YP G P+ F Sbjct: 88 YCASGFVREYPGGRCIPKLF 107 >AY545988-1|AAS99341.1| 423|Anopheles gambiae carboxypeptidase B precursor protein. Length = 423 Score = 22.6 bits (46), Expect = 9.5 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 384 PWGYEWSHPP 355 PWGY++ H P Sbjct: 317 PWGYDFLHAP 326 >AJ627286-1|CAF28572.1| 423|Anopheles gambiae carboxypeptidase B protein. Length = 423 Score = 22.6 bits (46), Expect = 9.5 Identities = 6/10 (60%), Positives = 8/10 (80%) Frame = -3 Query: 384 PWGYEWSHPP 355 PWGY++ H P Sbjct: 317 PWGYDFLHAP 326 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 638,480 Number of Sequences: 2352 Number of extensions: 13542 Number of successful extensions: 55 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 43 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55506924 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -