BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0109.Seq (508 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0925 - 12440917-12441560,12441675-12441810 31 0.53 01_01_0134 - 1224084-1224269,1224578-1224662,1224763-1225050,122... 31 0.53 02_05_0482 + 29382696-29383251,29383376-29383692 30 1.2 01_01_0017 + 133311-133615,133698-133824,133912-134253 29 2.1 06_01_0900 + 6926600-6927202 28 3.7 05_03_0355 - 12885898-12886290,12886351-12886644,12886744-128868... 28 5.0 01_03_0022 + 11724319-11725381,11725476-11725582 28 5.0 01_06_0030 + 25756294-25756575,25756977-25757101,25757276-257573... 27 6.5 >03_02_0925 - 12440917-12441560,12441675-12441810 Length = 259 Score = 31.1 bits (67), Expect = 0.53 Identities = 17/56 (30%), Positives = 26/56 (46%) Frame = +2 Query: 290 NVFTKGYFVTLLIFIYIIYYRGVCIESASECVGCTCAREHRRDTPPTSAPHTRTCT 457 N++++GY + ++ RG+ S C CA +HRR P A T T T Sbjct: 53 NLYSQGYGTSTAALSTALFNRGL---SCGSCYELRCAGDHRRSCLPGGATVTVTAT 105 >01_01_0134 - 1224084-1224269,1224578-1224662,1224763-1225050, 1225114-1225334,1225511-1225642,1226218-1226494, 1226722-1226770,1226993-1227088,1227779-1227911, 1228241-1228391,1228484-1228674,1229167-1229382 Length = 674 Score = 31.1 bits (67), Expect = 0.53 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +3 Query: 99 GSTWRPKISKRSTTKHKNGLYRFF 170 GS + PK+ ++STTKH+ G +R F Sbjct: 338 GSEFSPKLIQKSTTKHRRGWWRQF 361 >02_05_0482 + 29382696-29383251,29383376-29383692 Length = 290 Score = 29.9 bits (64), Expect = 1.2 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 114 VARSNLGGKVPKPSARAGRERWGAG 40 ++R LG K P P R G+ER G G Sbjct: 38 LSRKRLGAKPPSPQRRGGQEREGGG 62 >01_01_0017 + 133311-133615,133698-133824,133912-134253 Length = 257 Score = 29.1 bits (62), Expect = 2.1 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = +2 Query: 368 SASECVGCTCAREHRRDTPPTSAPHTRT 451 S+S C + R+ PP APHT T Sbjct: 6 SSSTASAAACCKSRSRNPPPAPAPHTST 33 >06_01_0900 + 6926600-6927202 Length = 200 Score = 28.3 bits (60), Expect = 3.7 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -3 Query: 437 VRRWGACLGGARARTCIRRTRSHSRYILHG 348 VR W + G R +T IRR R R+ HG Sbjct: 76 VREWSELVAGPRWKTFIRRFRRSPRHHHHG 105 >05_03_0355 - 12885898-12886290,12886351-12886644,12886744-12886871, 12886952-12888482 Length = 781 Score = 27.9 bits (59), Expect = 5.0 Identities = 10/30 (33%), Positives = 20/30 (66%) Frame = -3 Query: 287 IPKVYIFLFGLKKKRIAYLVFYSFSLIINS 198 +PKV++ +FGL+KK YL ++ ++ + Sbjct: 657 LPKVWVKVFGLRKKLREYLTLWAVGSLLGA 686 >01_03_0022 + 11724319-11725381,11725476-11725582 Length = 389 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +1 Query: 91 PT*VRPGDRRFLNVPLQNIKTD 156 P VRPGDRR L P +I D Sbjct: 252 PKWVRPGDRRLLQAPASSITPD 273 >01_06_0030 + 25756294-25756575,25756977-25757101,25757276-25757313, 25757501-25757611,25757703-25757782,25758264-25758318, 25758465-25758851,25759080-25759223,25759630-25759671, 25759755-25759837 Length = 448 Score = 27.5 bits (58), Expect = 6.5 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = +2 Query: 5 KGRAGSAARGVSPAPQRSRPALADGFGTFPP 97 + +G G SP P+R+ PA AD PP Sbjct: 43 RAASGIPGPGGSPVPRRTTPAPADAAAAAPP 73 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,596,565 Number of Sequences: 37544 Number of extensions: 253471 Number of successful extensions: 925 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 903 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -