BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0109.Seq (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7745| Best HMM Match : Lectin_C (HMM E-Value=4.2e-05) 32 0.24 SB_5179| Best HMM Match : Neur_chan_memb (HMM E-Value=3.5e-08) 31 0.41 SB_33587| Best HMM Match : SAMP (HMM E-Value=2.7) 29 2.9 SB_49328| Best HMM Match : DUF1091 (HMM E-Value=1.6) 28 3.8 SB_11573| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_41396| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.92) 28 3.8 SB_16310| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.8 SB_50285| Best HMM Match : SAP (HMM E-Value=0.0036) 28 5.1 SB_6206| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.1 SB_484| Best HMM Match : bZIP_1 (HMM E-Value=1.4) 28 5.1 SB_48760| Best HMM Match : bZIP_1 (HMM E-Value=0.95) 27 6.7 SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 SB_53740| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 27 8.9 >SB_7745| Best HMM Match : Lectin_C (HMM E-Value=4.2e-05) Length = 322 Score = 32.3 bits (70), Expect = 0.24 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +1 Query: 268 NIYTLGI*CFYERLFCNVVDIYLYYLLPWSMYRECERVRRMH 393 N YT+ I C+Y + C V +YL++ L + +ECE H Sbjct: 158 NTYTILILCYYPAILCIVKPVYLFFGL--GVDKECESCYSFH 197 >SB_5179| Best HMM Match : Neur_chan_memb (HMM E-Value=3.5e-08) Length = 428 Score = 31.5 bits (68), Expect = 0.41 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 4/82 (4%) Frame = +2 Query: 230 LNMQFFFFLSQTKIYTL*GSNVFTKGY-FVTLLI--FIY-IIYYRGVCIESASECVGCTC 397 L++ FFF + T I T +V +GY ++ L + +Y ++YY G S +E + Sbjct: 350 LDVIFFFICAITMIVTY---SVLLRGYKYMELSLDKLVYNLVYYFGATKYSVTEIMKIVL 406 Query: 398 AREHRRDTPPTSAPHTRTCTPR 463 HRR+ + H +C PR Sbjct: 407 CSIHRRNVYVSLYIHLLSCAPR 428 >SB_33587| Best HMM Match : SAMP (HMM E-Value=2.7) Length = 488 Score = 28.7 bits (61), Expect = 2.9 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 367 ECERVRRMHVRARAPPRHAPHLR 435 +CE V R H+ R+PP + P L+ Sbjct: 423 QCESVARKHMPRRSPPAYKPQLK 445 >SB_49328| Best HMM Match : DUF1091 (HMM E-Value=1.6) Length = 555 Score = 28.3 bits (60), Expect = 3.8 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = +3 Query: 108 WRPKISKRSTTKHKNGLYRFFVENVTFYTLAVDDERKTVK 227 + P K T KH GL+ + ++T + DER+ V+ Sbjct: 174 YEPAAMKAFTQKHSPGLFEMLLSSITREDSRLSDERQAVQ 213 >SB_11573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 405 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 352 WSMYRECERVRRMHVRARAPPRHAP 426 WSM+ EC + R+ V +R PP +P Sbjct: 146 WSMFNECFPLIRVKVSSRDPPYMSP 170 >SB_41396| Best HMM Match : Tymo_45kd_70kd (HMM E-Value=0.92) Length = 806 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +2 Query: 383 VGCTCAREHRRDTPPTSAPHTRTCTPRTLHLTS 481 V + + ++RR +P + +PH+ T TP +TS Sbjct: 653 VSSSASSKNRRSSPVSRSPHSTTGTPNATGITS 685 >SB_16310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 28.3 bits (60), Expect = 3.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 352 WSMYRECERVRRMHVRARAPPRHAP 426 WSM+ EC + R+ V +R PP +P Sbjct: 12 WSMFNECFPLIRVKVSSRDPPYMSP 36 >SB_50285| Best HMM Match : SAP (HMM E-Value=0.0036) Length = 1136 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 352 TVINNINKYQQRYKIAFRKNIRSLKCI 272 T++ + N+Y Q Y+ F SLKCI Sbjct: 179 TMVTSENEYVQEYRARFEIKTNSLKCI 205 >SB_6206| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 27.9 bits (59), Expect = 5.1 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = +3 Query: 117 KISKRS-TTKHKNGLYRFFVENVTFYTLAVDDER-KTVK 227 KIS +S T KHK L R ++ FYT D + KT+K Sbjct: 34 KISTKSKTAKHKKDLSRLQKKDPEFYTFLQDKSKSKTIK 72 >SB_484| Best HMM Match : bZIP_1 (HMM E-Value=1.4) Length = 263 Score = 27.9 bits (59), Expect = 5.1 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = -1 Query: 352 TVINNINKYQQRYKIAFRKNIRSLKCI 272 T++ + N+Y Q Y+ F SLKCI Sbjct: 179 TMVTSENEYVQEYRARFEIKTNSLKCI 205 >SB_48760| Best HMM Match : bZIP_1 (HMM E-Value=0.95) Length = 221 Score = 27.5 bits (58), Expect = 6.7 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 349 VINNINKYQQRYKIAFRKNIRSLKCI 272 ++ + N+Y+Q Y+ F SLKCI Sbjct: 1 MVTSENEYEQEYRARFEIKTNSLKCI 26 >SB_21412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1015 Score = 27.5 bits (58), Expect = 6.7 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -2 Query: 123 KSSVARSNLGGKV-PKPSARAGRERWGAGLTPLAADPARPLP 1 +S + S+L K+ P P+ R+G+ + G P+ A +RP+P Sbjct: 937 ESDFSLSSLDDKLKPVPAQRSGQGKRDQGNAPVPASRSRPVP 978 >SB_53740| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 1980 Score = 27.1 bits (57), Expect = 8.9 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = +2 Query: 377 ECVG--CTCAREHRRDTPPTSAPHTRTCTPRTLHLTS 481 +C G C C +H ++TP T TC P ++H+ S Sbjct: 530 QCYGKECWCVDKHGQETPGTRTTGLITC-PASVHVLS 565 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,533,716 Number of Sequences: 59808 Number of extensions: 288051 Number of successful extensions: 879 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 879 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -