BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0108.Seq (810 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0506 - 19794383-19794670,19795066-19795140,19795337-197987... 29 3.3 07_03_1056 + 23619815-23619957,23621080-23621188,23622555-23622635 29 4.4 >12_02_0506 - 19794383-19794670,19795066-19795140,19795337-19798704, 19799503-19799671,19799758-19799850 Length = 1330 Score = 29.5 bits (63), Expect = 3.3 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = -3 Query: 529 LRSFNKFTETLCSQTSFITMNRPVLELLYIVPSRLYASSLYLC 401 LRS +TL S S + N P+LE L +P L+A + C Sbjct: 1163 LRSLPSTMDTLHSLRSLVLCNAPLLETLPAMPPNLWALQISGC 1205 >07_03_1056 + 23619815-23619957,23621080-23621188,23622555-23622635 Length = 110 Score = 29.1 bits (62), Expect = 4.4 Identities = 10/34 (29%), Positives = 17/34 (50%) Frame = -2 Query: 212 CKCCDRLTIFKLDKGYRIKNSYVSSSSVLKRQLM 111 C CC RL ++ +K Y Y +L++ +M Sbjct: 73 CSCCQRLLGWRYEKAYSEDQKYKEGKYILEKHMM 106 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,907,227 Number of Sequences: 37544 Number of extensions: 366723 Number of successful extensions: 584 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 584 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2209429392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -