SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= pg--0104.Seq
         (432 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase prot...    25   0.41 
AJ606487-1|CAE55183.1|  203|Tribolium castaneum Giant protein pr...    21   5.0  

>AJ876407-1|CAI45288.1|  590|Tribolium castaneum phosphatase
           protein.
          Length = 590

 Score = 24.6 bits (51), Expect = 0.41
 Identities = 15/32 (46%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = +3

Query: 318 QLSVIDVLNKYSHDSDNDVAYNAIFAM-GLVG 410
           Q  V  VL+K + DSD DV Y+A  A+ G+ G
Sbjct: 559 QPQVKPVLDKLTADSDIDVKYSASEAIAGIAG 590


>AJ606487-1|CAE55183.1|  203|Tribolium castaneum Giant protein
           protein.
          Length = 203

 Score = 21.0 bits (42), Expect = 5.0
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -2

Query: 272 PHCRLPYLPSCP 237
           PH   PY P CP
Sbjct: 23  PHSPEPYPPRCP 34


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 63,756
Number of Sequences: 336
Number of extensions: 930
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 52
effective length of database: 105,113
effective search space used:  9565283
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

- SilkBase 1999-2023 -