BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0103.Seq (626 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0244 - 27130502-27130843,27130914-27131019,27132170-27132411 30 1.3 12_01_1024 - 10467644-10469274,10469424-10469482,10469820-104703... 30 1.7 01_06_0495 - 29779499-29781325 29 2.3 08_01_0038 - 282431-283954 27 9.2 01_06_1729 + 39486553-39487413,39487953-39488020,39489574-394901... 27 9.2 >02_05_0244 - 27130502-27130843,27130914-27131019,27132170-27132411 Length = 229 Score = 30.3 bits (65), Expect = 1.3 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -3 Query: 423 RPSARSFRFLPFLSRHVRRLSPSSSKSGAP 334 R SA R+ PFLSR +R S S+ SG P Sbjct: 191 RRSATDGRYAPFLSRQPQRSSAGSTHSGKP 220 >12_01_1024 - 10467644-10469274,10469424-10469482,10469820-10470357, 10470975-10471666,10471912-10472062,10473797-10473864, 10473964-10474042,10474763-10474765,10476427-10477255 Length = 1349 Score = 29.9 bits (64), Expect = 1.7 Identities = 14/31 (45%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = -3 Query: 435 YTCQRPSA-RSFRFLPFLSRHVRRLSPSSSK 346 Y CQ P ++FRF+ SRH R+ SS K Sbjct: 1313 YECQEPGCGQTFRFVSDFSRHKRKTGHSSDK 1343 >01_06_0495 - 29779499-29781325 Length = 608 Score = 29.5 bits (63), Expect = 2.3 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = -1 Query: 626 TLPFSILLKHLSGLLSHERIHI*MYLEK*TNRGSAHISPKVPPDAP--CSGALSA 468 +LP+ L +HL+GLL +H + + T+R + H+ VP P C +SA Sbjct: 6 SLPYRHLPQHLAGLLKTRPLHD-LLSDASTSRAARHLFDAVPRPTPALCGTLISA 59 >08_01_0038 - 282431-283954 Length = 507 Score = 27.5 bits (58), Expect = 9.2 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +1 Query: 7 FPTVAQLQW-RMANCKR*YFVKIRVKFLLNQLIF*PIGRNRQNPL*IKRIDRDRVECCSS 183 FP++A+L R C + Y VK R LL+QLI + R + L + D ++ S Sbjct: 227 FPSLARLPVVRRLLCAKAYHVKRRWDQLLDQLIDDHASKRRSSMLDNNDEESDFIDVLLS 286 Query: 184 LEQE 195 ++QE Sbjct: 287 IQQE 290 >01_06_1729 + 39486553-39487413,39487953-39488020,39489574-39490154, 39490623-39491432,39491738-39493035 Length = 1205 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 435 YTCQRPS-ARSFRFLPFLSRHVRRLSPSSSK 346 Y C P A++FRF+ SRH R+ S K Sbjct: 1169 YVCHEPGCAQTFRFVSDFSRHKRKTGHSVKK 1199 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,811,090 Number of Sequences: 37544 Number of extensions: 316581 Number of successful extensions: 752 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1525730988 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -