BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0102.Seq (789 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC211.06 |gfh1||gamma tubulin complex subunit Gfh1|Schizosacch... 25 9.4 SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces po... 25 9.4 >SPBC211.06 |gfh1||gamma tubulin complex subunit Gfh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 577 Score = 25.4 bits (53), Expect = 9.4 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -1 Query: 252 VTDMKLIFLLNDRDELLRLSNKKANSNSFDS*KLLVL 142 V+ +KL+ + ++ DE++R N+K + + LL L Sbjct: 360 VSFLKLVSIFDEEDEMIRSENRKIDVEGLNMQLLLCL 396 >SPAC30D11.04c |nup124||nucleoporin Nup124|Schizosaccharomyces pombe|chr 1|||Manual Length = 1159 Score = 25.4 bits (53), Expect = 9.4 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +2 Query: 344 LIKHVIKAFFCFRKSVYKVFRFIDDVMTFQKPRQVLKSNRLL 469 L K IKAF + + ++F DDV P+Q KS R+L Sbjct: 333 LEKGHIKAFSAVDEDLDEIFACEDDVHYTALPKQNPKSERIL 374 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,757,937 Number of Sequences: 5004 Number of extensions: 50809 Number of successful extensions: 106 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 106 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 383374054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -