BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0102.Seq (789 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0389 - 13409848-13409964,13410049-13410114,13410209-134103... 29 5.6 02_05_1025 + 33588053-33589998,33590357-33590630,33591031-33591354 28 7.4 >05_03_0389 - 13409848-13409964,13410049-13410114,13410209-13410325, 13410822-13410893,13410979-13411258,13411528-13411730, 13412230-13412316,13412705-13412758,13413042-13413221, 13414402-13414576,13414628-13414918,13414923-13415344 Length = 687 Score = 28.7 bits (61), Expect = 5.6 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 45 FFYVNRA*YKNVSDYCKETIVSKFFLLRDRTIPALIASNYQSYY 176 +FY NR N D C +SKFFL+ S++Q +Y Sbjct: 93 WFYTNRV-AVNTWDKCSTAFLSKFFLMGKTNALRRRISSFQEFY 135 >02_05_1025 + 33588053-33589998,33590357-33590630,33591031-33591354 Length = 847 Score = 28.3 bits (60), Expect = 7.4 Identities = 11/26 (42%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 620 YLPARTHKRSYHQYTSQYIF-TSHYI 546 YLPA H+R YH + Y++ HY+ Sbjct: 127 YLPADLHRRFYHGFCKHYLWPLLHYL 152 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,396,605 Number of Sequences: 37544 Number of extensions: 326487 Number of successful extensions: 654 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 639 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 654 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2127163404 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -