BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0100.Seq (362 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 25 0.21 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 1.9 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 2.6 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 2.6 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 4.5 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 20 7.8 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 20 7.8 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 20 7.8 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 20 7.8 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 25.4 bits (53), Expect = 0.21 Identities = 17/45 (37%), Positives = 21/45 (46%) Frame = +1 Query: 40 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILALIHALRTLT 174 M C P DT +Y+F R Y + T VI A+ L TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 1.9 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +3 Query: 12 YACIKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 125 Y C + + LRR + ++++VP + +SYL Sbjct: 215 YPCCDEPYPDIFFNITLRRKTLFYTVNLIVPCVSISYL 252 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 2.6 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +3 Query: 12 YACIKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 125 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 2.6 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +3 Query: 12 YACIKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 125 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.0 bits (42), Expect = 4.5 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +3 Query: 12 YACIKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 125 Y C + + ++ +RR + +++++P + +S+L Sbjct: 220 YTCCDEPYLDITFNITMRRKTLFYTVNLIIPCMGISFL 257 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 20.2 bits (40), Expect = 7.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 46 QCKPY*GDTANGSIYQFWFLRSY 114 +C Y D + +YQ++ LR Y Sbjct: 140 RCLHYTVDKSKPKVYQWFDLRKY 162 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 20.2 bits (40), Expect = 7.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 46 QCKPY*GDTANGSIYQFWFLRSY 114 +C Y D + +YQ++ LR Y Sbjct: 145 RCLHYTVDKSKPKVYQWFDLRKY 167 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 20.2 bits (40), Expect = 7.8 Identities = 8/38 (21%), Positives = 20/38 (52%) Frame = +3 Query: 12 YACIKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 125 Y C ++ + LRR + +++++P + +S+L Sbjct: 216 YICCEEPYPDIVFNITLRRKTLFYTVNLIIPCVGISFL 253 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 20.2 bits (40), Expect = 7.8 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +1 Query: 46 QCKPY*GDTANGSIYQFWFLRSY 114 +C Y D + +YQ++ LR Y Sbjct: 145 RCLHYTVDKSKPKVYQWFDLRKY 167 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 99,236 Number of Sequences: 438 Number of extensions: 2063 Number of successful extensions: 10 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8556345 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -