BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0099.Seq (715 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory recept... 22 5.7 AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory recept... 22 5.7 AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory recept... 22 5.7 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 7.5 >AM292368-1|CAL23180.2| 387|Tribolium castaneum gustatory receptor candidate 47 protein. Length = 387 Score = 21.8 bits (44), Expect = 5.7 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +3 Query: 132 SSNFAEPADGVLL----QSPSTKLLINDQELGTATLYITENNVIW 254 S+ AE VL+ S STK+L D + + I V+W Sbjct: 187 STALAESFQNVLVPTASNSKSTKVLFKDVDRNCSAYIIAHYRVLW 231 Score = 21.4 bits (43), Expect = 7.5 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 245 VVFSDVQRSCA*FLIIY 195 V+F DV R+C+ ++I + Sbjct: 210 VLFKDVDRNCSAYIIAH 226 >AM292347-1|CAL23159.2| 387|Tribolium castaneum gustatory receptor candidate 26 protein. Length = 387 Score = 21.8 bits (44), Expect = 5.7 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +3 Query: 132 SSNFAEPADGVLL----QSPSTKLLINDQELGTATLYITENNVIW 254 S+ AE VL+ S STK+L D + + I V+W Sbjct: 187 STALAESFQNVLVPTASNSKSTKVLFKDVDRNCSAYIIAHYRVLW 231 Score = 21.4 bits (43), Expect = 7.5 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 245 VVFSDVQRSCA*FLIIY 195 V+F DV R+C+ ++I + Sbjct: 210 VLFKDVDRNCSAYIIAH 226 >AM292327-1|CAL23139.2| 387|Tribolium castaneum gustatory receptor candidate 6 protein. Length = 387 Score = 21.8 bits (44), Expect = 5.7 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 4/45 (8%) Frame = +3 Query: 132 SSNFAEPADGVLL----QSPSTKLLINDQELGTATLYITENNVIW 254 S+ AE VL+ S STK+L D + + I V+W Sbjct: 187 STALAESFQNVLVPTASNSKSTKVLFKDVDRNCSAYIIAHYRVLW 231 Score = 21.4 bits (43), Expect = 7.5 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -3 Query: 245 VVFSDVQRSCA*FLIIY 195 V+F DV R+C+ ++I + Sbjct: 210 VLFKDVDRNCSAYIIAH 226 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 7.5 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 14 LFFLITNKPRDWKSFIKN 67 L+F I + DWK +KN Sbjct: 79 LYFDIDKQTCDWKDSVKN 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,986 Number of Sequences: 336 Number of extensions: 2923 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18947110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -