BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0099.Seq (715 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g40770.1 68415.m05030 SNF2 domain-containing protein / helica... 28 5.3 At4g04990.1 68417.m00728 expressed protein contains Pfam domain ... 27 9.3 >At2g40770.1 68415.m05030 SNF2 domain-containing protein / helicase domain-containing protein / zinc finger (C3HC4 type RING finger) family protein low similarity to SP|P36607 DNA repair protein rad8 {Schizosaccharomyces pombe}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 1648 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/56 (23%), Positives = 25/56 (44%) Frame = +3 Query: 168 LQSPSTKLLINDQELGTATLYITENNVIWAEALVHQAIQLRPSIYSIQAYLYMRYN 335 L SP ++ + Q + IW ++++H LRP + + +A R+N Sbjct: 181 LLSPRVRVEMLQQAFDACDSLLENTRQIWKKSMIHVMSWLRPEVMTSEARYGTRFN 236 >At4g04990.1 68417.m00728 expressed protein contains Pfam domain PF05553: Cotton fiber expressed protein Length = 303 Score = 27.5 bits (58), Expect = 9.3 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 707 SASWPLPGRGPSLMRR 660 ++SWPLP R PS RR Sbjct: 202 TSSWPLPSRSPSRARR 217 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,556,504 Number of Sequences: 28952 Number of extensions: 253309 Number of successful extensions: 510 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 510 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -