BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0097.Seq (724 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ912404-1|ABK33662.1| 172|Homo sapiens calcium-sensing recepto... 30 9.6 BC011571-1|AAH11571.1| 903|Homo sapiens ITCH protein protein. 30 9.6 AL356299-4|CAI17959.1| 903|Homo sapiens itchy homolog E3 ubiqui... 30 9.6 AL356299-3|CAI17960.1| 862|Homo sapiens itchy homolog E3 ubiqui... 30 9.6 AL109923-6|CAI21458.1| 903|Homo sapiens itchy homolog E3 ubiqui... 30 9.6 AL109923-5|CAI21459.1| 862|Homo sapiens itchy homolog E3 ubiqui... 30 9.6 AF095745-1|AAK39399.1| 862|Homo sapiens ubiquitin protein ligas... 30 9.6 AF071111-1|AAD20804.1| 95|Homo sapiens unknown protein. 30 9.6 AF038564-1|AAC04845.1| 739|Homo sapiens atrophin-1 interacting ... 30 9.6 AB056663-1|BAB39389.1| 862|Homo sapiens ubiquitin protein ligas... 30 9.6 >DQ912404-1|ABK33662.1| 172|Homo sapiens calcium-sensing receptor protein. Length = 172 Score = 29.9 bits (64), Expect = 9.6 Identities = 20/58 (34%), Positives = 32/58 (55%) Frame = +2 Query: 287 VAAPGLDAYHCVISFTENHMYVTSSVFTSAHGWQPVDIVDCAGDARVLTDQQCANLKK 460 V P +D H IS+ ++Y+ +V++SAH Q DI C + T+ CA++KK Sbjct: 117 VETPYIDYTHLRISY---NVYL--AVYSSAHALQ--DIYTCLPGRGLFTNGSCADIKK 167 >BC011571-1|AAH11571.1| 903|Homo sapiens ITCH protein protein. Length = 903 Score = 29.9 bits (64), Expect = 9.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 320 HSGTRPARVPRPHHPQPXKPDPERPYILN 234 + G +P+R PRP P P P P RP +N Sbjct: 245 NGGFKPSRPPRPSRPPP--PTPRRPASVN 271 >AL356299-4|CAI17959.1| 903|Homo sapiens itchy homolog E3 ubiquitin protein ligase (mouse) protein. Length = 903 Score = 29.9 bits (64), Expect = 9.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 320 HSGTRPARVPRPHHPQPXKPDPERPYILN 234 + G +P+R PRP P P P P RP +N Sbjct: 245 NGGFKPSRPPRPSRPPP--PTPRRPASVN 271 >AL356299-3|CAI17960.1| 862|Homo sapiens itchy homolog E3 ubiquitin protein ligase (mouse) protein. Length = 862 Score = 29.9 bits (64), Expect = 9.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 320 HSGTRPARVPRPHHPQPXKPDPERPYILN 234 + G +P+R PRP P P P P RP +N Sbjct: 204 NGGFKPSRPPRPSRPPP--PTPRRPASVN 230 >AL109923-6|CAI21458.1| 903|Homo sapiens itchy homolog E3 ubiquitin protein ligase (mouse) protein. Length = 903 Score = 29.9 bits (64), Expect = 9.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 320 HSGTRPARVPRPHHPQPXKPDPERPYILN 234 + G +P+R PRP P P P P RP +N Sbjct: 245 NGGFKPSRPPRPSRPPP--PTPRRPASVN 271 >AL109923-5|CAI21459.1| 862|Homo sapiens itchy homolog E3 ubiquitin protein ligase (mouse) protein. Length = 862 Score = 29.9 bits (64), Expect = 9.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 320 HSGTRPARVPRPHHPQPXKPDPERPYILN 234 + G +P+R PRP P P P P RP +N Sbjct: 204 NGGFKPSRPPRPSRPPP--PTPRRPASVN 230 >AF095745-1|AAK39399.1| 862|Homo sapiens ubiquitin protein ligase ITCH protein. Length = 862 Score = 29.9 bits (64), Expect = 9.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 320 HSGTRPARVPRPHHPQPXKPDPERPYILN 234 + G +P+R PRP P P P P RP +N Sbjct: 204 NGGFKPSRPPRPSRPPP--PTPRRPASVN 230 >AF071111-1|AAD20804.1| 95|Homo sapiens unknown protein. Length = 95 Score = 29.9 bits (64), Expect = 9.6 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -3 Query: 317 SGTRPARVPRPHHPQPXKPDPE 252 S + P +P+PH P P P+PE Sbjct: 41 SHSSPTGLPKPHSPMPSPPEPE 62 >AF038564-1|AAC04845.1| 739|Homo sapiens atrophin-1 interacting protein 4 protein. Length = 739 Score = 29.9 bits (64), Expect = 9.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 320 HSGTRPARVPRPHHPQPXKPDPERPYILN 234 + G +P+R PRP P P P P RP +N Sbjct: 81 NGGFKPSRPPRPSRPPP--PTPRRPASVN 107 >AB056663-1|BAB39389.1| 862|Homo sapiens ubiquitin protein ligase Itch protein. Length = 862 Score = 29.9 bits (64), Expect = 9.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 320 HSGTRPARVPRPHHPQPXKPDPERPYILN 234 + G +P+R PRP P P P P RP +N Sbjct: 204 NGGFKPSRPPRPSRPPP--PTPRRPASVN 230 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 96,001,006 Number of Sequences: 237096 Number of extensions: 1759817 Number of successful extensions: 4699 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4390 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4664 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8511181328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -