BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= pg--0090.Seq (460 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein. 30 1.3 BT021324-1|AAX33472.1| 264|Drosophila melanogaster RE08647p pro... 28 6.9 AE014297-2161|ABC66177.1| 297|Drosophila melanogaster CG8927-PB... 28 6.9 >X95908-1|CAA65152.1| 1494|Drosophila melanogaster orf protein. Length = 1494 Score = 30.3 bits (65), Expect = 1.3 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = -1 Query: 244 DGFSPFDVGVHVL**WTLVPNWNNTQPYLGLFF*FIRDFADFGLLVKK*ADLTK 83 DG P D G+ + + + N + Q +LGL F R DF L K D+ K Sbjct: 923 DGIMPNDKGIEAIKNFPIPNNVHTVQSFLGLCSYFRRFIKDFSRLAKPLHDILK 976 >BT021324-1|AAX33472.1| 264|Drosophila melanogaster RE08647p protein. Length = 264 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = +1 Query: 187 EQESTIKERGLQRQRAKNRLSGRGPLREPSP*SSFLGSRCRKALNRNPKGSPRFRA*R 360 EQ+ ++ +Q A L+G+ P+ +PSP FL S + P S RF A R Sbjct: 94 EQQLAQAQQSQFQQAAAAFLAGQQPVEQPSPVQQFLQSDDSQPAAILPPPSSRFPAER 151 >AE014297-2161|ABC66177.1| 297|Drosophila melanogaster CG8927-PB, isoform B protein. Length = 297 Score = 27.9 bits (59), Expect = 6.9 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = +1 Query: 187 EQESTIKERGLQRQRAKNRLSGRGPLREPSP*SSFLGSRCRKALNRNPKGSPRFRA*R 360 EQ+ ++ +Q A L+G+ P+ +PSP FL S + P S RF A R Sbjct: 94 EQQLAQAQQSQFQQAAAAFLAGQQPVEQPSPVQQFLQSDDSQPAAILPPPSSRFPAER 151 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,342,825 Number of Sequences: 53049 Number of extensions: 369006 Number of successful extensions: 746 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 746 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1518217281 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -